SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000002297 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000002297
Domain Number 1 Region: 707-903
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-51
Family DBL homology domain (DH-domain) 0.000000255
Further Details:      
 
Domain Number 2 Region: 905-1038
Classification Level Classification E-value
Superfamily PH domain-like 3.04e-34
Family Pleckstrin-homology domain (PH domain) 0.00000986
Further Details:      
 
Domain Number 3 Region: 311-456
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.49e-32
Family Regulator of G-protein signaling, RGS 0.0000092
Further Details:      
 
Domain Number 4 Region: 8-88
Classification Level Classification E-value
Superfamily PDZ domain-like 9.73e-20
Family PDZ domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000002297   Gene: ENSLOCG00000001976   Transcript: ENSLOCT00000002302
Sequence length 1425
Comment pep:known_by_projection chromosome:LepOcu1:LG5:1584070:1618796:-1 gene:ENSLOCG00000001976 transcript:ENSLOCT00000002302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSLPDAGLVQRCVIVQRDQLGFGFTVCGERIKLVQNVRPGGAAVKAGVQEGDRIIKVNG
SLVSSMSHQEVVKLIKSGTYVALTLQGPTPSNASLPLQPLPTDTSPNHRAAPGGVAPPPP
LPPAPASVSLTSSQRITGPRPLQVTYHSSSSDPVLSTLLAQLLESPDSLARQHGPSLTLL
LQKRKKKTLQVIFLQKKNNNRRSSSAVAGPGRLSMDSQDGDFEGFESPRSSPSLSARASQ
HRRQGSETIFMSDQGSRPQIIGPEEEEDDEDSQTQNEEASRYPKSCIVLFLTFSLADCCF
VFPPLPKPRQLFYLSVEAYLSASPKDARHMASQIYANFLDKEAPLKIRVSDDFMADIDGR
LHAQEDIRGPLSDMQLQVLPEIQEQIQDYRNKQMIGLGSLFGEGDLQLLDGDPAKEKQIV
DRQVTALWEILSKHEEDRSAPIASAILLYLRHAGIKLRDSRVFSMLDKSQEKDKWLPFFP
KTKKPNTTKKEREKEKDAEEKKRNPILKYIAKPRSTSQSTFHVPLSPTEEFLSSFRRNVG
KLRTASDWGGCLILDSSMLTFSFCLRSLYVSPGGGGVKLARSESLKAQGEVRKPRVEVVP
RSRSDVDMDDAAEEREREGARLHQSASSSASSLSARSLENPTPPYTPRSRRNLSRSRSLT
VLRRLSTKNSCLPDCPPASHCVFTNLKCLETPAGPESRNPAGFLDLLFTTESSHLRTLRV
LDQVFLQKMKGVLNQEELGCIFPNLPEVLEAHSSLCESMKKLRESLIVNTIGDIMLARFE
GPAGQEFQEKVSQFCSRQAQALELIKSKQQKDPRFQQLIQECEANPQCRRLQLKDLLVSE
MQRLTKYPLLLGNIIKYTDTSSSDLPSLQRAQDCCRGILKNVNEAVKETENRHRLCQYQR
RLDLTVLERMTNPIAAQFRNLDLTTKRMIHEGPLTWRVSKDKALEIQALLLEDILVLLQR
VDDRLILRCPSRNLGGGNNDVKMSFSPIVSLDSLLVRSVATDNKALYVISTSERQIYELV
AGTSSEKNTWKDLLEKAIALASRSPGPAEQREAPVTSSSLDLDTAVSPGSGVYQSEDSLT
ESSASMETEPPEDEDDDVLTPTPPADPSVNGGDDISGPVAEILPPPAFERGIADAALDDV
ENLRQLIFRNIDDGWSQDSDDTPTNETANETPRGISPFQELAERGRGETGSHAPPVSNNQ
SELQETEIPSPQSQLPIKVVRKEIIAAEGAGTSSLPDDITDDVATDSSQSAKCSQAKEQS
NMFYLVMPESLKESSTDDPHTDTESSRARNGESDTRAKQDVTSSQRGPSASAAPAAPALG
TDRSQLRLFGQAQPPRAQRHVIRNVDEIFQAIEELTAKLHKLREIEVAHNQLLKGLSLQS
ANQERDHTQGESTVVRTRPFDRGAGDGKEGAPAELSQPEIQSTGF
Download sequence
Identical sequences W5M1N9
ENSLOCP00000002297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]