SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000002314 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000002314
Domain Number 1 Region: 765-898
Classification Level Classification E-value
Superfamily PH domain-like 2.35e-34
Family Pleckstrin-homology domain (PH domain) 0.00000986
Further Details:      
 
Domain Number 2 Region: 245-390
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.83e-32
Family Regulator of G-protein signaling, RGS 0.0000092
Further Details:      
 
Domain Number 3 Region: 625-763
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.1e-20
Family DBL homology domain (DH-domain) 0.0000334
Further Details:      
 
Domain Number 4 Region: 4-81
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-19
Family PDZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000002314   Gene: ENSLOCG00000001976   Transcript: ENSLOCT00000002319
Sequence length 1243
Comment pep:known_by_projection chromosome:LepOcu1:LG5:1584070:1618775:-1 gene:ENSLOCG00000001976 transcript:ENSLOCT00000002319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLVQRCVIVQRDQLGFGFTVCGERIKLVQNVRPGGAAVKAGVQEGDRIIKVNGSLVSSMS
HQEVVKLIKSGTYVALTLQGPTPSNASLPLQPLPTDTSPNHRAAPGGVAPPPPLPPAPAS
VSLTSSQRITGPRPLQEEVLQLWLGQLSRLSMDSQDGDFEGFESPRSSPSLSARASQHRR
QGSETIFMSDQLLSGLNSAGTYLRSFFKKNAVGIITALTLSRDPENTGDNNSTYVFPPLP
KPRQLFYLSVEAYLSASPKDARHMASQIYANFLDKEAPLKIRVSDDFMADIDGRLHAQED
IRGPLSDMQLQVLPEIQEQIQDYRNKQMIGLGSLFGEGDLQLLDGDPAKEKQIVDRQVTA
LWEILSKHEEDRSAPIASAILLYLRHAGIKLRDSRVFSMLDKSQEKDKWLPFFPKTKKPN
TTKKEREKEKDAEEKKRNPILKYIAKPRSTSQSIFFFLISSCTGRGAQAPGGSRAALPER
RGHGRRGRGEGEGGGPAAPVRLLLCLQPLCQVSRLPCPGVSPVSLTPLPSLSFPFLCCAS
FSLSHLSRRSHLPGFLFFRSLENPTPPYTPRSRRNLRAVISFPSLALRSPFFYPEQKQIT
DGFTETEHKEFLPSCESGTTDCSRLISPELFTTESSHLRTLRVLDQVFLQKMKGVLNQEE
LGCIFPNLPEVLEAHSSLCESMKKLRESLIVNTIGDIMLARVIGKHSLCPILSPPLPPTA
SSSDLPSLQRAQDCCRGILKNVNEAVKETENRHRLCQYQRRLDLTVLERMTNPIAAQFRN
LDLTTKRMIHEGPLTWRVSKDKALEIQALLLEDILVLLQRVDDRLILRCPSRNLGGGNND
VKMSFSPIVSLDSLLVRSVATDNKALYVISTSERQIYELVAGTSSEKNTWKDLLEKAIAL
ASRSPGPAEQREAPVTVEDSLTESSASMETEPPEDEDDDVLTPTPPADPSVNGGDDISGP
VAEILPPPAFERGIADAALDDVENLRQLIFRNIDDGWSQDSDDTPTNETANEELAERGRG
ETGSHAPPVSNNQSELQETEIPSPQSQLPIKVVRKAEGAGTSSLPDDITDDVATDSSRNM
FYLVMPESLKESSTDDPHTDTESSRARNGESDTRAKQDVTSSQRGPSASAAPAAPALGTD
RSQLRLFGQAQPPRAQRHVIRNVDEIFQAIEELTAKLHKLREIEVAHNQLLKGLSLQSAN
QERDHTQGESTVVRTRPFDRGAGDGKEGAPAELSQPEIQSTGF
Download sequence
Identical sequences W5M1Q6
ENSLOCP00000002314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]