SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000003062 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000003062
Domain Number 1 Region: 223-410,477-519,611-676
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.68e-51
Family Ankyrin repeat 0.00089
Further Details:      
 
Domain Number 2 Region: 541-745
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.35e-33
Family Ankyrin repeat 0.00066
Further Details:      
 
Domain Number 3 Region: 722-771,849-1027
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.09e-31
Family Ankyrin repeat 0.00088
Further Details:      
 
Domain Number 4 Region: 51-162
Classification Level Classification E-value
Superfamily POZ domain 2.56e-19
Family BTB/POZ domain 0.0041
Further Details:      
 
Domain Number 5 Region: 1050-1109
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.49e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000003062   Gene: ENSLOCG00000002602   Transcript: ENSLOCT00000003068
Sequence length 1115
Comment pep:known_by_projection chromosome:LepOcu1:LG22:2717213:2739691:1 gene:ENSLOCG00000002602 transcript:ENSLOCT00000003068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEEVAKLQKHLALLRQEYVKMQQRLAESEKRCAVLAAQANQESASATFIGRLLAIVAE
LYQQEQYSDLKVRVGEKEYRAHKFVLAARSETWSLANLATTTELDLSAPDAKPEVAMAML
RWAYTDELELKEDDVFLTDLMKLANRFQLQLLRERCEKGIMSSVNVRNCIRFYQTAEELS
ASTLMNYCAEIIASHWDDLRKEDFSTMSAQLLYKMIKSKTEYPLHKAIKVEREDVVFLYL
IEMDSQLPGKLNELDNNGDLALDLALSRRLESIATTLVNNKADVDMVDQSGWSLLHKAIQ
RGDEFASTFLIRHSAQVSAATVGAVETPLHLVCSFSPKKHCGEVMAGMARIAEALLKAGA
NPNMQNSKGRTPLHEAVVSGNEPVFNQLLQCKQLDLELKDHEGSTALWLALQYITVSSDQ
SVNPFEDSAPVVNGTSFDENSFAARLIQRGSDPNAPDSAAGNCLLQRAAGAGNEAAALFL
ATHGAKVNHTNKWGETPLHTACRNGLANLTAELLQQGANPNLQTERALPEGPQGQGVSLQ
SPLHMAIAYNHPDVVTVILEQKANALHATNNLQIIPDFSLKDSMGQTVLGLALWTGMHTI
AAQLLGSGAAINDTMSNGQTLLHMAIQRQDSKSALFLLEHQADINVRARDGETALQLAIR
NQLPLVVDAICTRGADMSVMDEKGNPPLWLALESGLEDIASTLVRHGCDATCWSPGPGGC
QQTLLHRAVDENTEGVACFLIRRSARDPRCPRLCWLSLVKSILIHPSDLAVGLVLLWTEM
ELISLLLMKQPPPRRLQAGGESSVGCGIRTRTLSCASQILTKPLLGTRLIQVRGSHLAFL
PKDYNRELMLARVYPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTI
CSVLLENGVDFAAVDENGNNALHLAVMQGRLNNVRTLLTESNVDAEAFNLRGQSPMHILG
QYGKENAAAIFELFLECMPAYPLDKPDNEGNTVLLLAYMKGNANLCRAIVRAGARLGVNN
NQGINIFNYQVATKQLLFRLLDMLSKEPPWCDGSNCYECAAKFGVTTRKHHCRHCGRLLC
HKCSMKEIPIIKFDLNKPVRVCDICFDVLTLGGVS
Download sequence
Identical sequences W5M3V4
ENSLOCP00000003062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]