SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000003449 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000003449
Domain Number 1 Region: 357-460
Classification Level Classification E-value
Superfamily SRCR-like 4.32e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000648
Further Details:      
 
Domain Number 2 Region: 490-596
Classification Level Classification E-value
Superfamily SRCR-like 6.41e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000684
Further Details:      
 
Domain Number 3 Region: 71-177
Classification Level Classification E-value
Superfamily SRCR-like 6.15e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 4 Region: 200-304
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000003449   Gene: ENSLOCG00000002933   Transcript: ENSLOCT00000003456
Sequence length 598
Comment pep:known_by_projection chromosome:LepOcu1:LG22:3231644:3245863:-1 gene:ENSLOCG00000002933 transcript:ENSLOCT00000003456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLSEEEMRGNSPDNLLRGWRPAIWLLALFLMSLLIVILMSCILQFAEIQKMLRQALPAVC
CDGAACHLKTIYSLRLANGRNRCEGRVEIQHNGTWGTVCDDDWDMVDANVVCRQLGCGLA
LAVASSSAFGQGTGPILLDNVDCRGGEGGLGQCESLGWGVHNCYHYEDVAVTCRDTSAPA
VREHSNFATPPPQLTGLREGTIRLVSGADSCQGRVEIFYRGSWGTVCDDDWGLRDADVVC
QQIGCGSALTYTTNAFFGYGTGLILLDNVNCNGNEPLLASCYSLGWGIHNCGHHEDAGVI
CSGSCTSTCPSLAHTGLTSTCSTTPTPSLNFTATMARALVYRMDATTETTFTKAGGAIRV
VNGNNTCQGRVEVFHNNAWGTVCDDDWDLANADVVCRQLGCGLAIEAKVLGYFGYGSGPI
LLDNVDCAGTENYLTDCFNLGWGQHNCGHHEDAGVICKAPSKPHIFDHGWKSAWIPIILV
PRSVTCAGACPPPGSVRLVNGTHRCEGRLELFSRAQWGTVCDDAWDLRDARVVCRQLGCG
NATSAREEAFFGQGSGSIHLDNLKCRGDETSLLQCSHIAWNVHNCNHSEDAGVTCQLL
Download sequence
Identical sequences W5M4Z1
ENSLOCP00000003449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]