SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000003619 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000003619
Domain Number 1 Region: 617-812
Classification Level Classification E-value
Superfamily Sec7 domain 6.67e-72
Family Sec7 domain 0.0000026
Further Details:      
 
Domain Number 2 Region: 382-557,1117-1457,1633-1735
Classification Level Classification E-value
Superfamily ARM repeat 1.48e-26
Family MIF4G domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000003619   Gene: ENSLOCG00000003044   Transcript: ENSLOCT00000003626
Sequence length 1777
Comment pep:known_by_projection chromosome:LepOcu1:LG18:6591582:6637617:1 gene:ENSLOCG00000003044 transcript:ENSLOCT00000003626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQHADEIKAELEKQRDGSVVPPKANYIEADKYVLPFELACQSKSPRVVSTSLDCLQKLI
AYGHITGNAPDSGAPGKRLIDRIVETVCNCFQGPQTDEGVQLQIIKALLTTVTSPHIEIH
EGTILMTVRTCYNIYLASKNLINQTTAKATLTQMLNVIFARMESQATLETRELEKARHWQ
HQARQSPVPAAPAGSPRLDAPVHPEHRQPPEPQSEPAPDAQLPAGGSSEHLNGEPVEGSP
GTGEAQDRTSDPSQENAEVPKTEPHASAEPAGEVQESDPVPGKDAEEPLGDSEQQVSESK
DLRPPSDRTETAQTNGIVDDRASVSSTDILDTDAAHGPPTARFSHILQKDAFLVFRSLCK
LSMKPLADGPPDPRSHELRSKVVSLQLLLSVLQSAGPVFRTHEMFVNAIKQYLCVALSKN
GVSSVPDVFELSLAIFLTLLSNFKIHLKMQIEVFFREIFLTILETSSSSFEHKWMVIQTL
TRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRSGQELGMTPLQELSLRKKG
LECLVSILKCMVEWSKDLYVNPNLQTNLGQEKPPEQESGESRPLESCTRRDSVSSMDSTV
SSGIGSASTQASLADDPEQFEVMKQQKEIIEHGIELFNKKPKRGIQYLQEQGMLGTLPED
IAQFLHQEERLDTTQVGEFLGENIRFNKEVMYSYVDQLDFCGKDFVSALRIFLEGFRLPG
EAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNKMTKEQY
IKMNRGINDSKDLPEENLSAIYDEIAGKKIAMKESKEYSITPKSNKQNVASEKQRRLLYN
LEMEQMAKTAKALMEAVSHAQAPFTSATHLEHVRPMFKLAWTPLLAAFSIGLQDCDDQEV
ASLCLEGIRCAVRIASIFGMQLERDAYVQALARFTLLTASSSITEMKQKNIDTIKTLITV
AHTDGNYLGNSWHEILRCISQLELAQLIGTGVKTRYISGMVREREASIKGFPSGSEEFMP
LGLGNLVGGPDKRQMASIQESVGETSSQSVVVAVDRIFTGSTRLDGNAIVDFVHWLCAVS
MDELASPHHPRMFSLQKIVEISYYNMNRIRLQWSRIWQVIGDHFNKVGCNPNEDVAIFAV
DSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIRDMVIRCIAQMVNSQAANI
RSGWKNIFSVFHQAASDHDETIVELAFQTTGHIVVSTYQKHFAAAIDSFQDAVKCLSEFV
CNAAFPDTSMEAIRLIRHCAKYVSERPQALREYTSDDMNVAPGDRVWVRGWFPILFELSC
IINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWHDLFRIVFRIFDNMKLPEQQTEKTEWM
TTTCNHALYAICDVFTQFYDPLSDVLLPDIFTQIQWCVSQDNEQLARSGTNCLENLVILN
GEKFSPEVWEHTCLCMLDIFHNTSPHVLLTWRPASQEEDTGEKHMDVEVDSHSQSSYERN
LSDRGQSQMSNASDETWKGKSYAKIADQKLFAWLLIKCVVQLELIQTIDNIVFYPATSKK
EDADNMTAAQRDALDEGAPEEVGSQGMYGYMSSLHLFKLLDCLLESHSFAKAFNSNNEQR
TALWRAGFKGKSKPNLLKQETSSLACCLRILFRMYMDDKLKDSWSAIQARLLRVCSEALA
YFITLTSESHREAWTSLLLLLLTKTLKLTDDKFRDHASCYYPYLCEIMQFDLIPELRVVL
RRFFLRIGSVFKISSAEGQLRLVGDTEPGRVAPAAGV
Download sequence
Identical sequences W5M5G1
ENSLOCP00000003619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]