SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000003631 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000003631
Domain Number 1 Region: 665-860
Classification Level Classification E-value
Superfamily Sec7 domain 6.93e-72
Family Sec7 domain 0.0000026
Further Details:      
 
Domain Number 2 Region: 430-605,1165-1505,1682-1786
Classification Level Classification E-value
Superfamily ARM repeat 1.12e-26
Family MIF4G domain-like 0.085
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000003631
Domain Number - Region: 44-161
Classification Level Classification E-value
Superfamily ARM repeat 0.0263
Family Armadillo repeat 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000003631   Gene: ENSLOCG00000003044   Transcript: ENSLOCT00000003638
Sequence length 1826
Comment pep:known_by_projection chromosome:LepOcu1:LG18:6595906:6637617:1 gene:ENSLOCG00000003044 transcript:ENSLOCT00000003638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QWRSEARKAMQQKEESSKTKSMFLSRALEKILSDKEVKRAQHSQLRKACQVALDEIKAEL
EKQRDGSVVPPKANYIEADKYVLPFELACQSKSPRVVSTSLDCLQKLIAYGHITGNAPDS
GAPGKRLIDRIVETVCNCFQGPQTDEGVQLQIIKALLTTVTSPHIEIHEGTILMTVRTCY
NIYLASKNLINQTTAKATLTQMLNVIFARMESQATLETRELEKARHWQHQARQSPVPAAP
AGSPRLDAPVHPEHRQPPEPQSEPAPDAQLPAGGSSEHLNGEPVEGSPGTGEAQDRTSDP
SQENAEVPKTEPHASAEPAGEVQESDPVPGKDAEEPLGDSEQQVSESKDLRPPSDRTETA
QTNGIVDDRASVSSTDILDTDAAHGPPTARFSHILQKDAFLVFRSLCKLSMKPLADGPPD
PRSHELRSKVVSLQLLLSVLQSAGPVFRTHEMFVNAIKQYLCVALSKNGVSSVPDVFELS
LAIFLTLLSNFKIHLKMQIEVFFREIFLTILETSSSSFEHKWMVIQTLTRICADAQCVVD
IYVNYDCDLNAANIFERLVNDLSKIAQGRSGQELGMTPLQELSLRKKGLECLVSILKCMV
EWSKDLYVNPNLQTNLGQEKPPEQESGESRPLESCTRRDSVSSMDSTVSSGIGSASTQAS
LADDPEQFEVMKQQKEIIEHGIELFNKKPKRGIQYLQEQGMLGTLPEDIAQFLHQEERLD
TTQVGEFLGENIRFNKEVMYSYVDQLDFCGKDFVSALRIFLEGFRLPGEAQKIDRLMEKF
AARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKD
LPEENLSAIYDEIAGKKIAMKESKEYSITPKSNKQNVASEKQRRLLYNLEMEQMAKTAKA
LMEAVSHAQAPFTSATHLEHVRPMFKLAWTPLLAAFSIGLQDCDDQEVASLCLEGIRCAV
RIASIFGMQLERDAYVQALARFTLLTASSSITEMKQKNIDTIKTLITVAHTDGNYLGNSW
HEILRCISQLELAQLIGTGVKTRYISGMVREREASIKGFPSGSEEFMPLGLGNLVGGPDK
RQMASIQESVGETSSQSVVVAVDRIFTGSTRLDGNAIVDFVHWLCAVSMDELASPHHPRM
FSLQKIVEISYYNMNRIRLQWSRIWQVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLE
KGELANFRFQKDFLRPFEHIMKKNRSPTIRDMVIRCIAQMVNSQAANIRSGWKNIFSVFH
QAASDHDETIVELAFQTTGHIVVSTYQKHFAAAIDSFQDAVKCLSEFVCNAAFPDTSMEA
IRLIRHCAKYVSERPQALREYTSDDMNVAPGDRVWVRGWFPILFELSCIINRCKLDVRTR
GLTVMFEIMKSYGHTFEKHWWHDLFRIVFRIFDNMKLPEQQTEKTEWMTTTCNHALYAIC
DVFTQFYDPLSDVLLPDIFTQIQWCVSQDNEQLARSGTNCLENLVILNGEKFSPEVWEHT
CLCMLDIFHNTSPHVLLTWRPASQEEDTGEKHMDVEVDSHSQSSYERNLSDRGQSQMSNA
SDETWKGKSYAKIADQKLFAWLLIKCVVQLELIQTIDNIVFYPATSKKEDADNMTAAQRD
ALDEGAPEEVGSQGMYGYMSSLHLFKLLDCLLESHSFAKAFNSNNEQRTALWRAAGFKGK
SKPNLLKQETSSLACCLRILFRMYMDDKLKDSWSAIQARLLRVCSEALAYFITLTSESHR
EAWTSLLLLLLTKTLKLTDDKFRDHASCYYPYLCEIMQFDLIPELRVVLRRFFLRIGSVF
KISSAEGQLRLVGDTEPGRVAPAAGV
Download sequence
Identical sequences W5M5H3
ENSLOCP00000003631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]