SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000003743 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000003743
Domain Number 1 Region: 78-125
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 2 Region: 38-79
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000209
Family Somatomedin B domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000003743   Gene: ENSLOCG00000003169   Transcript: ENSLOCT00000003750
Sequence length 272
Comment pep:novel chromosome:LepOcu1:LG18:6695393:6700475:1 gene:ENSLOCG00000003169 transcript:ENSLOCT00000003750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRELAFMLCAAELWLQSPSCEGGCVDSGLCCTGRDPSCVSMGWRPDRSYGSCYCDQAC
TSALDCCHDYQQACPAASCAVGEWSVWSGCAEACQVTYRVRMRRVVREPRNGGVPCPPLQ
ERAGCVDYWPPHRECLPSLIPALITTGGFGKARKKRDLASSKDITGWVSSTTDLRYCVEF
QLMSLTAGCQYTTGPHTYWMRYLREGHIVCVECQPPALGNQHRRCHGDGEEAERGQLLRW
QSVGNARCRGSWRRLRRLESCSCPTVHSFLFI
Download sequence
Identical sequences W5M5T5
ENSLOCP00000003743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]