SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000003766 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000003766
Domain Number 1 Region: 67-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000851
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 2 Region: 117-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000003766
Domain Number - Region: 154-196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.017
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000003766   Gene: ENSLOCG00000003191   Transcript: ENSLOCT00000003773
Sequence length 200
Comment pep:known_by_projection chromosome:LepOcu1:LG10:3700290:3703861:-1 gene:ENSLOCG00000003191 transcript:ENSLOCT00000003773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANQANLRAALPPGCWEEWASCRCCSRRCACISAAVLLGLAVIAAAVASAIVLGIPPRPPV
NRYCTTAQNRSGFLCDDRVTCIPASDLCNGVKNCPSGADENPQMCADLPNNLPGNLIFRC
GNPQFWIFIDKKCNYINDCGDCSDEIGAYADCPPCGPGWWSCMPVVFMYCACVPRCLCRD
GQQHCSNWSDEYSCANKSCQ
Download sequence
Identical sequences W5M5V8
ENSLOCP00000003766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]