SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000003873 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000003873
Domain Number 1 Region: 1-20,97-206
Classification Level Classification E-value
Superfamily SNARE-like 2.38e-34
Family Sedlin (SEDL) 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000003873
Domain Number - Region: 51-83
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000599
Family PDZ domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000003873   Gene: ENSLOCG00000003274   Transcript: ENSLOCT00000003881
Sequence length 219
Comment pep:known_by_projection chromosome:LepOcu1:LG26:3747894:3750108:1 gene:ENSLOCG00000003274 transcript:ENSLOCT00000003881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIFSVYVVNKAGGLIYQYDNYVPRAEAEKTFSYPLDLVLKTHDERVIVSFGQRDGIRVG
HAVLSVNGVDVNGRYTADGKEIIEYLKDPSSYPVSIRFGKPRLSSNEKLMLASMFHSLFA
IGSQLSPEVGSSGIEMLETDTFKLHCFQTLTGIKFIVLADPRQSGIDALLRKIYEIYSDY
ALKNPFYSLEMPIRCELFDQNLKSALEVAEKTGTFGPGS
Download sequence
Identical sequences W5M665
ENSLOCP00000003873 XP_006642231.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]