SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000003952 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000003952
Domain Number 1 Region: 687-793
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-18
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000003952
Domain Number - Region: 50-384
Classification Level Classification E-value
Superfamily ARM repeat 0.000173
Family HEAT repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000003952   Gene: ENSLOCG00000003346   Transcript: ENSLOCT00000003960
Sequence length 807
Comment pep:known_by_projection chromosome:LepOcu1:LG14:4576274:4628891:-1 gene:ENSLOCG00000003346 transcript:ENSLOCT00000003960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHLFSLVLGHRDLSRAGDLFSLEDAEIEGCLSEALEEIKAISCSPDYLTNDNDQAVVEI
CITRITTAIRETHSIEKHGKALVSLWESCLEYNLKPEGKDEDTPHAKIASDIMSCVLQNY
DRPPVMALAVPVAVKFLQRGSRDLCRNMSSYLSLAAIAKADLLADHTEAITKSVLQGKAT
FVRFKSRVLLGRPDGCNSFIWEFSSMEKSLSHFYLQKITFLLQLYILHTWELSSSVPSLI
SYLNDPSVNDSILNVLVEISLCNPSVVAHYLPNLKAVGNEFPNLLGQIAKLYGAVGRTDE
EQARSCLVYLVTTLANMEHAFHHTLLLEIKGITDAFSSILGAYSKDVYRMSNSFTAIAKL
LVKKLESDRSLSRVEDKAEDPPKACDVNPTVKHDGESEKLQVKIQAFEEKMMSENSTPGP
VRRYSLSQAAKEERKEMRFNRSKSLALHVVRSKSMNSEHSQEEDGGDLPAEVCLSERSPS
QESCGTAVQGNSSADSVRESCQGGNAQTDALNGQNEDRLCQHLRDNLSKMKAFSAEMVKQ
IPVPEQCIIEVSDSIRSCVAKLFFSCPMKGQYCLYSKSSFSLSSRQPRVWIQIMLLYRQS
MSCEPLASDDKAVQLLKSMWEKTQLKGAHSFETAMMQSAFPHKKDLEALHTRLEEARFYD
LFGYSEETGGWLCFMCNNPEKATVVNQDGQPLIEGKLKEKQVRWRFIKRWKTRYFTLAGN
QLLFRKGKSKDDLDDSPLELSKVQSVKAVAKKRRDRSLPRAFEIFTESKTYVLKAKDEKN
AEEWLQCISVAVAQAKERENRESMTYL
Download sequence
Identical sequences W5M6E4
ENSLOCP00000003952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]