SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000003966 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000003966
Domain Number 1 Region: 1138-1334
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 919-1046
Classification Level Classification E-value
Superfamily PH domain-like 2e-30
Family Pleckstrin-homology domain (PH domain) 0.00000524
Further Details:      
 
Domain Number 3 Region: 42-164
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-18
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000003966   Gene: ENSLOCG00000003296   Transcript: ENSLOCT00000003974
Sequence length 1967
Comment pep:known_by_projection chromosome:LepOcu1:LG9:3372777:3431342:-1 gene:ENSLOCG00000003296 transcript:ENSLOCT00000003974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSSLSWSPGLQDRQRQEDHRQACADSRAKQKDAQEQSALASPAEEEPFSWPGPKTLRLRR
TSQGFGFTLRHFIVYPPESAVHSSLKDEENGNRGRQRNRLEPMDTIFVKQVKEEGPAHTA
GLCTGDRIVKVNGESIIGKTYSQVIALIQNSDTFLELCVMPKDEDILQLAYSQDAYLKGN
EAYSGNAQNIPEPPPLCYPRIDVKPAVMAQVPDASPSPEAARGAPQGSGPAGRAAWPAVA
PGGPPELGYRREITVPPSPPQLPKTKALVCVYQDAIRTVVVPPEAIERGGRASRAGPPHR
TEENRYGSDKARAPAAPSSSGGQKQFPLSRAAESPLFPSGGRPVQFPGSPDGPSGSVGPA
LTAAGDPFPAGPNHYSPSSSSSSSTSPAAHQHIDWRNYKTYKEYIDNKRLHMYGCRTIQE
RLDSLRAASQNSADYKQAAAAPGPWGVGSVQVRRRSTSHDRAYSNAAAAPMRSASQDRLG
GGEQAAALKDWPRSASQDALTSPLAGPPKPRARSCDYLGRQTETPPGDGFVAGAPGRVGD
RQTRGRAELEDRPLPYYEGARQPSRQSSSVRTAHPPHRTPTGYSPDIRMGGGSFRGISVL
PPFPKGTEQLHTSRADSLPHDAPHAVDRASRAVGKTPVTDPSPYAASAVPAGQGPGGSSA
LKDQRAVAGGHLPHAAPHLQPRARADGAREPASCSAAFRGNSGGKEQGEVSGAAEGLAVV
LREKPPSGRHTPQPLRHPSYILAVNEPEGGPPAEPTCWLPNDARREVNMKRLGEQRRASG
SSPPDDSLASIPFIDEPSSPSVDHDVAHIPASAVISVAPAITTIPPSPTSPSPVIRRQLS
HDQDSLRITILESQSGTKTERSKSYDEGLDNYREEGRSRSSIKHVSSLKGIKKAVDGQKS
SEDSGSRRDSSSDVFSDATKEGWLHFRQLSTDKSKRVGGGIRPWKQMYAVLRGPSLCLYK
DKKEALAHGSSQAEEELQQPISIRACLIDISYSDTKRKNVFRLTTSDCEHLFQAEDREDM
LSWIRVIQENSNLDEENAAVTSRDLISRKIKEYNTMMSSPSSRTEPSPKPSRQSIRQAFL
GGKGDPKAQSPHSPKHDSERKPLHKDDSSPPKDKGTWRKGIPGLMRKPFEKKTAAGVTFG
VRLDDCPPAQTNKFVPLIVEICCKLVEERGLEYTGIYRVPGNNSAISSMQEELNNKGMSD
IDVQDDKWRDLNVISSLLKSFFRKLPEPLFTNEKYADFIDANRTEDAVERLKILKRLLHE
LPDHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQY
KIVETLIQHYDWFFTEGASEDPRTPVREENTVESQPVPNIDHLLPNIGRTGTSPGDVSDS
ATSDSAKSKGSWGSGKDQYSRDLLVSSIFAAASRKRKKQKEKPQPSSSDDDLDNVFLQKE
PSRQNHDTVWSKDGSAEAGKETGASNQKGWTKETQDDKEQNKSFDLRTKAKKDHRNSFFL
KEKASSAQPSPSPSPSPKRTSSPSPSFRMQQGGKSSLSDPPSQFDDAVSDLGTMNSTSSQ
ASIHRARPKKWTTPDIKGNESIAAEISSITSDYSTTSSMTYLTGMESSMLSPEVQSVAES
KGDEADDERSELISDGRPMETDSESDFSVFASCSAPERILRESLQDKAQQRRRGSNGSEP
VGTEGSTTLKLDGWQIFPSQKLSESDVLYRKKTIHQKTDSESSAEGKSDKESNRLSRVLE
VMKKGKSTGSLSSSARSESEKQEPAWRLKITERLKFRLKTSADDMFGIGPPKARSPETRK
KKSIKRRHTMGGQRDFAELAVMNDWRGREQGGGDLESELSAVDRLKPKCHSQDFSIRDWI
ARERCRASNPEVDVDSAKEPRAAARDDEGPSKSTTPFSAQDDAEGPGGLTAISRPPPSAS
PGPRTAEQPNGDSLQSKSKTSLSLSADAHPHKLSGAHVVRSRFYQYL
Download sequence
Identical sequences W5M6F8
ENSLOCP00000003966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]