SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000004076 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000004076
Domain Number 1 Region: 11-114
Classification Level Classification E-value
Superfamily PDZ domain-like 9.46e-20
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000004076   Gene: ENSLOCG00000003428   Transcript: ENSLOCT00000004084
Sequence length 125
Comment pep:known_by_projection chromosome:LepOcu1:LG19:5048603:5055900:-1 gene:ENSLOCG00000003428 transcript:ENSLOCT00000004084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFIPGQPVTAVVIAESLILHIRRGIYVMIYGISVKSFISSQSEQYILTTEKHKNGIYVT
RVTPGGPAEVAGLMVGDKIMQVNGWDMTMVTHDQARKRLTKKNEDIVRLLVTRKSLEEAV
RHSMM
Download sequence
Identical sequences W5M6R8
ENSLOCP00000004076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]