SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000004628 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000004628
Domain Number 1 Region: 321-542
Classification Level Classification E-value
Superfamily Caspase-like 5.08e-35
Family Caspase catalytic domain 0.0099
Further Details:      
 
Domain Number 2 Region: 208-288
Classification Level Classification E-value
Superfamily Immunoglobulin 1.13e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 3 Region: 5-116
Classification Level Classification E-value
Superfamily DEATH domain 3.53e-16
Family DEATH domain, DD 0.0063
Further Details:      
 
Domain Number 4 Region: 103-174
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000261
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000004628   Gene: ENSLOCG00000003877   Transcript: ENSLOCT00000004636
Sequence length 816
Comment pep:known_by_projection chromosome:LepOcu1:LG19:5518948:5531738:1 gene:ENSLOCG00000003877 transcript:ENSLOCT00000004636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEWNLPLGTLGNGVLHRLADMLDNPTRGWRQLATALTDQPHLCCSEKELMSCSLQVLSA
KGSPSRYLLALLADRSCSLGCLLQCLKRIDHQEAVRYLTEKVMEQIRILVQPQAQRAPEG
GRVTLTCKASGPPGLAYQWFRGKEEVPNGSSPELVICPFSAAQQGHYICRVHHGENFLFS
DWAQVRLAQSSSSIPGIASGFFPSAVSLQITTQPKPLALSEGDPLCLECIAKGNPPPQYQ
WYHNKEPIRQALQPRLQISCVTTADRGQYSCRVYNTYHELWSDRAHVEIGPGSFTGSSWD
ERDEGHEPALLSRSLSVPLSATDKVALLMGNMNYHHHRQLRAPMADVHELTNLLRQLDFK
VVSLLDLNRQEMQSAVSEFLLLLDRGVYGLLYFAGHGYENYGNSFMVPIDSPATYTSEHC
LWVQDVLQRMQERETGLNVFLLDMCRKRNLNDDIIPQPGSLKVTANIVFGYATCVDAEAY
EVNKGSLSNGIFISFLKQRLLEDEKVTVMLDRVAEDMGQCEITRGRQALELRSNLSERRA
LTDRIRTSDSPEVTSARNLQWAIAHALPVSSDCAYIVHSVYIESVSFVRFEWISVGFTLH
SLMREKITSLQCCEDLEVDLKMTNQESPQDAGSLLFTMDSLPATEPACLYTRLSALQRLK
RDLTFTVCLHYQYSHMDEEVQERQLVTVGKPLVAKLNLHEPQAPCSSSFSSSDLQCLSLP
ESTSFSERLDSGSLTSFPASETSSLGSASTCWSYYSHPGDLTEVASPRRVNLPEETLSPE
FLDLDGPRPLSANPQSLPHERLTDVSFSFRSKQNFH
Download sequence
Identical sequences W5M8C0
ENSLOCP00000004628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]