SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000004722 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000004722
Domain Number 1 Region: 2118-2409
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.71e-94
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000156
Further Details:      
 
Domain Number 2 Region: 625-742
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-30
Family Second domain of FERM 0.00027
Further Details:      
 
Domain Number 3 Region: 1310-1414
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-28
Family PDZ domain 0.00046
Further Details:      
 
Domain Number 4 Region: 740-845
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-24
Family Third domain of FERM 0.0023
Further Details:      
 
Domain Number 5 Region: 1948-2050
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-24
Family PDZ domain 0.055
Further Details:      
 
Domain Number 6 Region: 1035-1145
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-23
Family PDZ domain 0.0067
Further Details:      
 
Domain Number 7 Region: 1448-1558
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-20
Family PDZ domain 0.024
Further Details:      
 
Domain Number 8 Region: 545-631
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.23e-18
Family First domain of FERM 0.0079
Further Details:      
 
Domain Number 9 Region: 1842-1922
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000025
Family PDZ domain 0.022
Further Details:      
 
Domain Number 10 Region: 1724-1813
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000618
Family PDZ domain 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000004722
Domain Number - Region: 77-169
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000547
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000004722   Gene: ENSLOCG00000003949   Transcript: ENSLOCT00000004730
Sequence length 2423
Comment pep:known_by_projection chromosome:LepOcu1:LG5:4697643:4739261:-1 gene:ENSLOCG00000003949 transcript:ENSLOCT00000004730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFVTLAEVLEVRGGPLEEDDIWSLLLGTTESLLEASYQGRRRFPQGVQNIICPGSLLLSA
NGSLAIKNSTLNDEVCVFMAPELLQGHALSSRLAMEKVHVYSLGMTLYWSADYHVPQNQP
IQLSDHLNCLLLSMCEDTAHKRVALQTILEACEMHHKASVLPPPNRVIKQLVEDVLQHSV
DRVSFSASAVLLSSRTQMIRERLHSKDSSVCPFHGEGEILTSTVDCEINEASKKSILPKD
SHPSPVRFHCVGPAGRQRPHSGYSDTNSASGESSGLPVDTETKQGISITSYDNGIKNVKS
INLLKDSEGFLTIVLEAKLTFAMHLINLDKSFFFVRSLKNYVTILIRQRKMKQPCLFFYT
EEKLCLFIVLLELLQPVYSTTLSVVCYEKRRNSDMQQKPELILNSEPGFGRVKSTEHYIE
SKAEMLCTAYPLCCAGYFTGTSRHQAGWMAHNKRLGGSMFLTSTDREQHTGSSCSWLNRS
SYLDVPHPSDNKSTQSRASSTSLTQKKSKNLGPEFIRMSGEPQIQLELPGSIVTKKGKTS
SVQRALLVLMPNGQSIQVKCEMKSKARDIFDMVVAHANLVEHFYFGLAFIDDDEFFFLDH
DTKISKVAPEGWKKGTPIGFVLFLRIKFFVDDISFIQHGVTRHQYYLQMRRDLLEERLYC
SNETALYLGALALQAEFGDYVPEVYGMNYFQPEHYIPKTVIEKLVLSFLKDELPRLHANN
ARLPAEEAEIEFLKVTQQLPEYGVLFHRLARAKKPRGGDLILGICAKGIIVYEVKNNSRI
ASLRFQWRETERISSTRKKFAVESSTSGKKHSFLTESSRISKYLLNLCSAQHKFQSEMSS
RQLSQSLAAAKSAPLWINQGPLDVIKGNVVYQKGSTPRYAAPCDQHERLKRLSCSETVLT
RDENGVPSNPLSKSCDDISIKMDKTISDQTWRYTFLSLNLNKIENKDYQIAVVKICQFST
PDLLSSLSLPVSHVQSSTSLQNKDSERTLDHPSSSGLTALNWNLTITESIIVEISKERKA
KTHLLKQSSGNCSVIPPMPASVSDYFQNKVAMPQREIICVSLKKDPKLGLGFVIVGDDST
GKLDLGIFIASIISDGPADKDGRIKPGGRLISLNKMSLEGVTFNTAAGILQNCPEDVELI
ISQPKSMFIFCIACHTVKDLKLAWHELLSINGRSKISLRDLSPTGSCQCLFHQSNNLLHY
LMPADPATNRNNSKYKSHRSQSSVEKRCDCHIVPTAEQYVDSNMVTPGSVRRLQVPAVRI
LDGQVFCSISLIWLILPVQVKTEGNEIKQIWLNFWILKKNSDSCFSQDALCQSESQQANV
IPSEVHFVELKKIDGSLGISVTGGVNTSVRHGGIYIKAVVPGGAADQDGHIQKGDCLLEV
DGVSLRSFTHRQAVECLKNTGEVVHLVLRREQHGAPEPPGAKSPRAPAAPPAPAATHRSR
EHHATVSTATPLSIKAKDYSFVAEDNTFEVTLKKNLSGLGFSFLWTDCSPISEDHKGIFR
VKKLFPGQPAEESGKIEVGDVILAVNKKSVKGMSYWDVLHLLRGGPEEVTLSLCRPAPGL
LPEVDVNAVTPAPSPTKEIKSRLTGLQLADVTIHEYESTSREKTDEEAPSRAGSLAEPKQ
LVDSCQSKTELHSSSAAEDTDGTVRYSVLSKPSSRADEEYLTISTASATPPGPVTVPSLR
AHAKAEQSSSSSAEWEDVEEEEEEKKAPQPKSCEAAHFKTHFSLYSRICKEFELSVTLVK
SPSGSFGFTIVRSKLDSCYYIQDILDNPAKADGRLRAGDRVITVRKRNEDPVSLKEHFTF
LKNFRRHIQYKILEVALVKSGKKKFFETYSIHSFYCARSVPAAAGIKLTGGIGSKWQGIY
VLEVVSASPASEEGSLQPRDKILYICGKCTMGMSLQEAVKACESAARKVKIKATRDDQPV
VPKGRWNALLLQLKTCAVPVCKARDSSSRDSLVLLCPFSLQSCIVQVDIQKPEKGGLGFA
LVGGSSGIALRVKGICPGSVAQLDGRLQVGDILLEVNGDIVSGLSHNKVVEMLRKAEGTV
CLTVSRNLPASSSECVKQLSETHRHNPQHTELQYSSLCPKHSSGGWSSDEDDEVLLPSVQ
DIQPSTGRIIVSEKELARLSLISPPANGQYCGSRVKELIETLQLRLEQQEVVKEFMALEH
LKPSDNCLIGKAPENREKNRYRDILPYDKTRVPVGEQQGYINASFIRMSVGPEENWYISS
QGPLPGTVDLFWQMVWENKSDVIAMMTQEVERGRVKCHRYWPEELNVPMDTSKYQLHLDN
FQIHHYFHINIIRMIEKETGGTHIVKHFKFTTWPDHCTPRSSDQLVRFILYMRSVHRQGP
VIVHCSAGIGRTGVLICTDVILTMIEKDLNINVSDIVKEMRQQRYGMIQTKEQYLFCYTV
WLEVLQSILLLQNGNQGQQENVL
Download sequence
Identical sequences W5M8L4
ENSLOCP00000004722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]