SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000004965 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000004965
Domain Number 1 Region: 871-1062
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00069
Further Details:      
 
Domain Number 2 Region: 41-75
Classification Level Classification E-value
Superfamily WW domain 0.0000000549
Family WW domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000004965   Gene: ENSLOCG00000004130   Transcript: ENSLOCT00000004973
Sequence length 1067
Comment pep:known_by_projection chromosome:LepOcu1:LG18:8816353:8883342:1 gene:ENSLOCG00000004130 transcript:ENSLOCT00000004973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETSSDWVEILEPRSRERMYVNLVTGECGWEPPPSVEVRQCDGRQWWELFDGNNNRFYY
YNSATQQTVWHRPQSCDIVPLAQLQAMKRSSESERRGHGRPRGGGGGSEGRQTPLQGAYL
VPPPQDGDSTGRETPAKGRADSLDNRKEPGRETPQRWQPAPGTKAAMLVKVNSMGRNQPT
GPIDTPQNHHHNNTHPANSAARKPAGGFVYPADKTPVPGKMAVPVDSKQALHLKKTDNGS
FCLVTPVNGSSSSVYQTPHRSQAGTPRPVSPQYAATPPIYDEPPLESPIYDEPPVEMEVE
GAPLNNGPSPPHFSPTHSLQKQGQLQHPHQQTKLLQYPATHLGSKHKRSPSATEYSPAGR
ECIRHMVNVDSGSSSKPAGPPLSSTPHTGSSERPSGKQKEGSGEKKQSWRILEANVLKSI
EARHSRQNSLASQEYPTAATVNYQDSGYSTGPSPSLRRKNRRRQMAGQGRPGSVGSSGEL
NALNEKLMAEMRAVVGRSSTLRGSKVSLDTEMSENSIPRARSPLDSLKKYSGRNGSREDV
TASNRSLYRTGLDARGSAQGDTPLSPLALEGLGRQKRTYEKVDSLEKSVTSQISLSSPEP
PRSPSQAGTLESKENFGNGKQGGSGSSGSSYQYPYATLCKPPADVNMVDWASKNLNMHTQ
GIFRRRVSIANMLSWNRGSIKKPMLITSDRTVKKEACEMFKLVQVYMGDRQARLERRHVA
LLIVTKCWSMQGLRDELYIQLVRQTTDNLCLRSLAAGWELMAISLAFFSPSPKFRRYLEG
YIQRHLEPGYDKKVTQHITEQLEMKNKKNSKSRKKRKQNTEEEEGLPISTYAKYCYRKLQ
KVAVTGGKKGLRKPTLEEIDHAKNAVVTPSLFGSALEEIMERQQELFPERKLPWVQVQLS
QHVLGLGGAQTEGIFRVPGDIDEVNALKLQVDQWKIPENLSDPNVPASLLKLWYRELEEP
VIPQSFYRQCISNYEDPEAAIAVVQSLPELNRLVLCYLIHFLQVFAQPVNVSKTKMDVNN
LAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRVLIVHLDTSFVKGLV
Download sequence
Identical sequences W5M9A6
ENSLOCP00000004965 XP_006639579.2.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]