SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000005036 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000005036
Domain Number 1 Region: 993-1277
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.56e-81
Family Protein kinases, catalytic subunit 0.000000000197
Further Details:      
 
Domain Number 2 Region: 324-485
Classification Level Classification E-value
Superfamily L domain-like 2.47e-51
Family L domain 0.000000405
Further Details:      
 
Domain Number 3 Region: 27-186
Classification Level Classification E-value
Superfamily L domain-like 1.79e-44
Family L domain 0.00000063
Further Details:      
 
Domain Number 4 Region: 483-606
Classification Level Classification E-value
Superfamily Fibronectin type III 1.59e-33
Family Fibronectin type III 0.00000194
Further Details:      
 
Domain Number 5 Region: 792-934
Classification Level Classification E-value
Superfamily Fibronectin type III 8.15e-21
Family Fibronectin type III 0.0000271
Further Details:      
 
Domain Number 6 Region: 610-689,797-821
Classification Level Classification E-value
Superfamily Fibronectin type III 5.5e-19
Family Fibronectin type III 0.00012
Further Details:      
 
Domain Number 7 Region: 172-326
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000722
Family Growth factor receptor domain 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000005036   Gene: ENSLOCG00000004179   Transcript: ENSLOCT00000005044
Sequence length 1365
Comment pep:known_by_projection chromosome:LepOcu1:LG19:5958712:6053873:1 gene:ENSLOCG00000004179 transcript:ENSLOCT00000005044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLDTPVVAFVTFICVLSNCGISDGEICKSMDIRNNITHLHAIENCTVIEGHLKILLMFK
TKPEDFRGLRFPKLTMITDYLLLFRVYGLESLRDLFPNLTVVRGTNLFFNYALVLFEMLQ
LKEIGLHSLMNITRGAVRIEKNPDLCYLSTLDWSKILDSVEDNYIVSNKDDRECGDVCPG
TAKGKTSCPQTIFNGHFSERCWTQDHCQRTCPSSCKHRACTKEGQCCHDECLGSCTAPND
PRKCVACRRYLHQGACVDNCPAGSYIFEGWRCVSFKFCQDLHNKCKQGTGCDEYVIHNGE
CIPECPSGYTTMNSTMLNCTPCAGLCPKVCTGVKTVDSVTAAQALRGCTILNGSLVINIR
GGNNIAAELEANLGQLEEITGYLKIRRSYALVSLSFLRKLKLIRGEVLESGNFSFYALDN
QNLRQLWDWSKHNMTILQGRMFFHFNSKLCMSEIRKMEEVTGTKGRDIKNDISMKTNGDQ
ASCETQVLKFTQIRTLSDKIIIKWEPFWPPDYRDLLGFMVLYKEAPYRNVTEFDGQDACG
SNSWVIADVDPPPRASDGRDQVEPGHLIHPLKPWTQYAIFVKTLLSASDEHQVHGAKSEI
IYVRTNATKPSVPLDPISSSNSSSQIMLKWKPPTDANGNITHYLVFCQQQPEASDLYKFD
YCQKGMKLPSRAPTHQDTEEAQKWNQTDEPGQSGRCCSCPKTETQLKREAEESEYRKTFE
NYLHNEVFEIRTSSAGLETNEDRPSRRRRSLGAVANSTIQRFFTTPSTLPNASTTRGPEE
EEGAKVVLTVHAKESAVISSLRHFTSYQIEIHACNHPTDPSRCSMAAYVSARTMPEDKAD
DIVGQVTHEVLTNTVHIRWQEPKSPNGMIILYEVNYKRLGDSEELHHCVSRKSYSVDQGC
KLRVLHPGNYSVRIRATSLAGNGSWTEPTYFYVQDPRDPSSVMKIAIGSVICIVLILVVA
GAVFMVVRKKQTEGPTGPLYASSNPEYLSANDVYVPDEWEVPREKIDVLRELGQGSFGMV
YEGIAKEIVKGEPETRVAVKTVNESASLRERIEFLNEASVMKSFSCHHVVRLLGVVSKGQ
PTLVVMELMTHGDLKSYLRSLRPDAENNPGRPPPTLKEMIQMAAEIADGMAYLNAKKFVH
RDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHS
DCWSFGVVLWEISTLAEQPYQGLSNEQVLKFVMDGGYLDRPDNCAERLHNLMQMCWQYNP
KMRPTFHEIIEMLKDDLHPSFQEVSFFYSEENKPPETEEFDMDFENMESIPLDPSSYSQR
EESLGRDNGPSMGLRGNYEEHVPYTHMNGGKKNGRILSLPRSSPS
Download sequence
Identical sequences W5M9H7
XP_015220966.1.81211 ENSLOCP00000005036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]