SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000005145 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000005145
Domain Number 1 Region: 321-407
Classification Level Classification E-value
Superfamily DEATH domain 3.92e-19
Family DEATH domain, DD 0.00049
Further Details:      
 
Domain Number 2 Region: 59-114
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000173
Family TNF receptor-like 0.0023
Further Details:      
 
Domain Number 3 Region: 115-152
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000393
Family TNF receptor-like 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000005145
Domain Number - Region: 158-215
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000159
Family TNF receptor-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000005145   Gene: ENSLOCG00000004304   Transcript: ENSLOCT00000005153
Sequence length 441
Comment pep:known_by_projection chromosome:LepOcu1:LG25:8368260:8381879:-1 gene:ENSLOCG00000004304 transcript:ENSLOCT00000005153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSGWFCLWLLPLTLASHTWKESAPYSTAQWTSATLARTSRTTHRKGNGRVRRHTVSCG
EHQFLDREANRCCNKCLPGHYKQSSCSDNTNQTRCAPCKEGSFMDQYNHVLTCHRCRSCD
HAKLEEVKKSCNSTSNTVCGCKKGSYRKNDSQDFPCAKCSLCHNRTIKENCSENADTQCG
DCVPGLYQDKHGECQPCRNCSVIQREREHCHSFSDQVADCRSCRLTFFLEFTCLLKSTNC
SSFVGICKRKYRDRGNFILRCSIDSRYKLQRFGRTAQRTTKTHLQADEKNNLVTVKLWPT
VKAQLRSMPGAVAAKEEPPADAWPPAVLYAIIEEVPVRRWKEFMRVLALPDGEMERVELE
LAPSYRERQYQMLRLWSQRRGAELQSVHAALHSMDLPGCSQELQEKLVFLMTPKPTAPAL
SYPSLIQYRPEAGEASAGPAQ
Download sequence
Identical sequences W5M9T6
ENSLOCP00000005145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]