SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000005359 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000005359
Domain Number 1 Region: 739-934
Classification Level Classification E-value
Superfamily Sec7 domain 2.49e-76
Family Sec7 domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 479-679,1236-1584
Classification Level Classification E-value
Superfamily ARM repeat 3.69e-29
Family Plakophilin 1 helical region 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000005359   Gene: ENSLOCG00000004389   Transcript: ENSLOCT00000005367
Sequence length 1905
Comment pep:known_by_projection chromosome:LepOcu1:LG9:6353116:6449736:1 gene:ENSLOCG00000004389 transcript:ENSLOCT00000005367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKEETEKLSPPPGDTKA
GSSTLPPVKSKANFIEADKYFLPFELACQSKCPRIVSTSLDCLQKLIAYGHLTGSAPDST
APGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVTSQQIEIHEGTVLQAVRTCYN
IYLASKNLINQTTAKATLTQMLNVIFARMENQALTNHKITWSLASRKRERQKLLRRSIFS
AQSVSFQEARQMEKERQRQQHLQQSPVSQHEPDSPRLRRPKEQPAKPPPQEPDGGAPPTA
SEAEKSAQEDPEPENGSEFCSAENEQTEADQATAAAESLSKHDAEVIDEEEAPNYEEKAQ
EIVQSILKEVVNTVVGDSGESAGGESAEGTPGSLEEEGGLGSDSEHVHANGIPGTPISAS
FAPSLPDDRLSVSSNDTQESGVTTGPSPGAKFSHILQKDAFLVFRSLCKLSMKPLSDGPP
DPKKTAGKNSWKNWMKSHELRSKVLSLQLLLSILQNAGPIFKTNEMFINAIKQYLCVALS
KNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETSTSSFDHKWMVIQ
TLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRAGHELGMTPVQELSLRK
KGLECLVSILKCMVEWSKDQYVNPNSQTSLGQEKPSEQETNETKHPETINRYGSINSLDS
TASSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFNKKPKRGIQYLQEQGMLGTTP
EDIAQFLHQEERLDSTQVGEFLGDNDRFNKEVMYAYVDQMDFQGKDFVSALRMFLEGFRL
PGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNKMTKE
QYIKMNRGINDSKDLPEEYLSAIYDEIAGKKISMKETKELTIKSNKQSVASEKQRRLLYN
VEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVGLQDCDDTDV
ASLCLEGIRCAIRIACIFAIQLERDAYVQALARFTLLTASSGITEMKQKNIDTIKTLITV
AHTDGNYLGNSWHEILKCISQLELAQLIGTGVKARYISGTVRSKEGPIAGTKELSSDEYV
GLGLVGGNVDRKQIASIQESIGETSSQSVVVAVDRIFTGSTRLDGNAIVDFVRWLCAVSM
DELASPTHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIGDHFNKVGCNPNEDVAIFAVD
SLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIRDMVVRCIAQMVNSQAGNIR
SGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTNVFEKHFPATIDSFQDAVKCLSEFAC
NASFPDTSMEAIRLIRHCAKYVSERPQAFKDYTSDDMNVAPEDRVWVRGWFPILFELSCI
INRCKLDVRTRGLTVMFEIMKTYGHTYEKHWWQDLFRIVFRIFDNMKLPEQQTEKAEWMT
TTCNHALYAICDVFTQYFEALNDVLLDDILSQLYWCVQQDNEQLARSGTNCLENVVILNG
EKFTLETWDKTCNCMLDIFKTTIPHALLTWRPSGAENEPPAQVDISDKQLDSISQKSLDI
QARADDQQSTGSMEKLSLENRRQSQFSVGSAVLEDGRQARTPTKAQEQKLFAALLIKCVV
QLELIQTIDNIVFFPATSKKEDAENLAAAQRDTLDADVHVDTQDQGMYRYLTSEQLFKLL
DCLLESHRFAKAFNSSNEQRTALWKAGFKGKSKPNLLKQETSSLACGLRILFRMYTDECR
REAWEEVQKQLLNVCSEAISYFLTLTSESHREAWTNLLLLFLTKVLKISDDRFKAHASRY
YPLLCEIMQFDLIPELRAVLRKFYLRIGIVFKISQTPSQEDGDRE
Download sequence
Identical sequences W5MAF0
ENSLOCP00000005359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]