SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000005778 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000005778
Domain Number 1 Region: 1407-1517
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-33
Family PDZ domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 1825-1999
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.35e-28
Family Nucleotide and nucleoside kinases 0.00015
Further Details:      
 
Domain Number 3 Region: 1576-1673
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-20
Family PDZ domain 0.003
Further Details:      
 
Domain Number 4 Region: 677-788
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-17
Family PDZ domain 0.002
Further Details:      
 
Domain Number 5 Region: 800-872
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-16
Family PDZ domain 0.016
Further Details:      
 
Domain Number 6 Region: 1-94
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000254
Family Caspase recruitment domain, CARD 0.015
Further Details:      
 
Domain Number 7 Region: 1678-1756
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000171
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000005778   Gene: ENSLOCG00000004786   Transcript: ENSLOCT00000005786
Sequence length 2002
Comment pep:known_by_projection chromosome:LepOcu1:LG5:6461888:6518908:-1 gene:ENSLOCG00000004786 transcript:ENSLOCT00000005786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKHKELLDQCHQNLLESITDADSLVELLGKAGTLSQLEKYELDNNCSSSSEKVDLLLK
MLMNKERDHFPDLCVALEKTHPHLCSALFINGGGPLDHSSGSTYSVLSTMPSDSESSSSL
SSIGTTGKASSPPPALIDNRQMSEKLDTILFQLRQVTRERDELRKRLALSSPGTTFDDCR
PNSKPSHDYEHLKIQCVKVMADLQSLQNQHTKTLKRCEEAVKEADFYHTLHSRLLSDQSQ
LKEEVEAMKRDSSQLVREHNHLKQTCEELKRRHDEDQKEVAEMRLQQQQVMRENGSSEIL
NQLYDTAVDKLDGVKKDYEALRKRYNEKVANHNTDLSRLEQVEEENQRLQKQVDALMKQR
DAAIHYQQQYSSSLRRFEAIQQELSKAAAQNKELQREVERLQSEATRFKTLQLKAAKDCE
KYKEERDSVFSEYRLIMSERDQVIKEVDKLQTELEVAEAKLKNTSSERKVASEEMEALRQ
ELNSALVDRDRAICERNELLEKYCHEVKDKAEAQKELNQACKDIETVKEERDVARKERTE
AIIQRDQLLREYYQARQKQDSATLDMERANKEIEMLRKQYEAMTQELKEAVQEAEVAKCR
RDWAFQERDKIVAERESIRTLCDNLRRERDRAVSDLAEALRNLDDMRKQRNDALRELKEL
KEKMENQLEKEARFRQLMAHNSHDSAIDTDSLEWETEVVEFEKDREDMDLKALGFDVAEG
VNDPYLPGDCGIFVTRVDKGSIADGRLRVNDWLLKINDVDLTNKDRKQVIKAVLTGGGVI
NMVVRRRKSLGGRLVTPVHINLVGHKDCGIGLEAGVFVAAVVPGSAAAKEGSLTIGDRLI
AINGIALDNKSLTECEALLRNCRDSLSLSLIKFFPQSSSGQNIFENLRDLEKTSNCRVHS
SELHVRNSRNLKHNSSTQTDIFNPEGVEGKKDRSDSEDGSFCSQKPFSTGSLHTGSQRTV
EHSPGPFSADIFPDRCFGMVNLEKRGFTFDPAAADCIMMETTLEKGLRLKHSGGTWPKMM
VDVSASENAQLSIFKTPKSRKSIFDTDTFKRPEAPSAMNYLSPAQLPAHSPQASKVEVMQ
TPPTPPTRSDSFKFKHKQQTSSASDSTITTGSPAASPAQSPVTLGTKAEAVLEGRDRNGN
HYFVESTAEGKALTSRKSCDDDVGRQRAEEPEVKRPRPKSAPALRHKMTPLPVPVPTLQS
YSSEEPQSPDPHELVRYSPKRSHRHSVGFVPVVYNGAMAANSTHRGLAPCPAVTAVMRNP
IYTAWSHRVHTNNCPSVASQICHQHSHPSPQHQGRLSLDLSHKRTSDVPESSRSRTPHGT
NSLPSSARLVGSSSTLQYRTERIKIPSTPRYPRSMLGSDRGSLSHSECSSPSLITPPQSP
LNLETSSFASSQSQSSIATLPRISVSPVPMGERRKDRPYLEEPRNVVVHKGAEPLGISIV
SGENGGIFVSKVTGGSIAHQAGLEYGDQLLEYNGINLRNATEQQARLIIGQQCDTITILA
QYNPHMYQLGNHSRSSSRLEPIGNQSNPQGSGTTTPDNHSTIDTLSEQDEGTMTPPSKQT
TPTTSPRNSFRMPIDASKQIPEPRTVTIKKSQVELGIQICGGNLYGIFVESLEDDSPAKS
TGGLMLGDMILEYNSFQMKNKTAEEAYLELLKPADSVTLKVQYRIDEFNRIREMAGDGFY
IRALYDRVAEMEQDLSFKKDDILYVDDTLPKGNFGYWMAWQLDENAQKLERGQIPSKYMM
DQEFYRRHSMSEMKDDSGSSRTLSAAARRSFFRRKHKHKRSGSKDGKDLLALDAISTDSI
PFLEDCVSLAYQRVQKVECTSPRPVLILGPLVDAVKDMLVKESPGKFCRCLLEVMKASQQ
AIERGVKDCLFIDYKRRSGHFDVTTVASIKEITDKDCHCLLDIAPHAIERLHSVHIYPIV
IFIRYKNAKQIKEQKDPVFLRDKVSQKHSKEQFEVAQKTEQEYSKFFTGIVQGGSLAYIC
TQIMTIVDQEQNKVLWIPAGPL
Download sequence
Identical sequences W5MBL9
ENSLOCP00000005778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]