SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000005882 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000005882
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily DEATH domain 1.15e-20
Family Pyrin domain, PYD 0.0015
Further Details:      
 
Domain Number 2 Region: 116-201
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000848
Family Caspase recruitment domain, CARD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000005882   Gene: ENSLOCG00000004898   Transcript: ENSLOCT00000005890
Sequence length 202
Comment pep:known_by_projection chromosome:LepOcu1:LG24:2470823:2476610:1 gene:ENSLOCG00000004898 transcript:ENSLOCT00000005890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSVKDHILETLEDLEEKDLKKFKNKLCDREGEPKVPRGRVQKADAIDLVNLLVSYFTE
RGAAEVAIEVLRAINLNQEADELKNGTGKPTAFQAPSEKKMEEECRKTRFFFASTEVHFV
DRHRSALIQRVTMVAPILDALLTKKYVSQEEYSLILEERTPASRMRALLTGPMVTCGKRG
KDELCRILEQEQPILMEDLMGQ
Download sequence
Identical sequences W5MBX3
ENSLOCP00000005882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]