SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000005900 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000005900
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily DEATH domain 5.59e-16
Family Pyrin domain, PYD 0.0027
Further Details:      
 
Domain Number 2 Region: 126-210
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000203
Family Caspase recruitment domain, CARD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000005900   Gene: ENSLOCG00000004909   Transcript: ENSLOCT00000005908
Sequence length 211
Comment pep:known_by_projection chromosome:LepOcu1:LG24:2477690:2481118:1 gene:ENSLOCG00000004909 transcript:ENSLOCT00000005908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMAKSLKDHIIDTLEELDDKGLKKFRTKLCDRPGEPKIRKGQIQDADALDLANRLVSTFR
VDGAVRVTVEVLRDICENHLATTLSDKTKSLVGDISPSGSATGGGTCQEPAAPSSAPAIP
INMDEVNFVEKHRNDFIQRVTQVEPLLDELLVRGILNTEMYNSILAAPTHQEKMRRLFQG
PILSAGARGKRILYQILLEQQPFLIADLMGQ
Download sequence
Identical sequences W5MBZ1
ENSLOCP00000005900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]