SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000006267 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000006267
Domain Number 1 Region: 1826-1982
Classification Level Classification E-value
Superfamily SET domain 3.53e-47
Family Histone lysine methyltransferases 0.004
Further Details:      
 
Domain Number 2 Region: 125-211
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000102
Family Splicing factor U2AF subunits 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000006267   Gene: ENSLOCG00000005190   Transcript: ENSLOCT00000006275
Sequence length 1985
Comment pep:known_by_projection chromosome:LepOcu1:LG20:7063961:7094310:1 gene:ENSLOCG00000005190 transcript:ENSLOCT00000006275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YTMSKPGEKARLNEDHGRKQSSSLANGMEHSNPVCSSGEKRSHHWRSYKLIIDPALKKGP
HKLYRYDGQHFSMPNPGMPPVDTVRDPRIGRLWTKYKETDLPVPKFKIDDCYVGPVPPKE
VTFAKLNDNIREGFLTDMCKKFGEIEEVEILYNPKNKKHLGIAKVIFGTVKAAKEAVQNL
DNTSVMGNVIHVELDTKGENRMRYFELLVNGIYTPRTLPVGNEDSRDISPRSLNDTAQAG
EPAKRLSEGSSSAVGSSATPNSSSTPFSQDTAYSSCRQDTPNSYGQFTPQSQGTPLTPRL
GGTPFSQDSSYSSRQTTPAYQPNRAESSTGYKSRRHETKFQDAYNRRPERHYVHNTTGPY
RGSEQTSFSSPSFKPHSVPAEPTSAYTHTHTPPPPVAHPASYKSAFSPYQAPPPPVYPHT
VEPPFHPTPREQDYRRPAPPPAAEPFALSGASGGLDFVPVKEKPETPPLPEPPPPSESVG
AAPPGGRTPERSETPGTPTLESEMRNSLDSRIEMLLKEKRTKLPFLSGRDSDNEIRMEGS
PISSSSSQLSPIPPFTGNSQPGYRGPTPTSRPSSTGLEDISPTPLPDSDDDEPVRGTASL
VNRSGAASPADFNGQLGKTDSSEPKDSVSGDQTPTAEKMDVGNHSSGEDMEISDDEMPGT
PITSSECVVVNSSVSSSVMPQAIPIPPPGFPPPPPAPAPPPPPQPGFPLPPPPLPPPPAH
PAVPGPHPPLPGPPGVPPHPMLHTLHHYPPNMIPMMPMDLMTCLPQWGSMQMSFQMQTQM
LSRMMQGQRAYPYPPFMGGGGGGGMQFGNPYRPFTIGGGPAANVTHGYPWPPLPKFNPSV
PPPGYEPKKEDPHKATVDGVLMVIVKELKSIMKRDLNRKMVEVVAFRAFDEWWEKKERSA
KASLTPVKSADGKEEEKEKPKPKEPITSSLLENWNKGEGLGYEGIGLGIGLRGAIRLPSF
KVKRKEPPDPASSGDPKRVRPSTPVDDELEDEESEDLPSDVSKKDGDVGQVKRRHSRPLE
LDSEGEEEEETSGKEEEESSSDKEEQDETEPSEKLSSDKDVEELEEEEEEEEEDEIESDT
SEKEESDFSDEASSKAESSSSSSSSSSSEESEDSSEYETSSEEEEEVEDQEQTRVSSSDE
EQEEEETEAEELVGLKPPTPPLAPPLSEAVDQCLLGEARKSLEEVGLRDELQDRVSQEVE
DLRAARHEEFTADEPLTESEPDLRPPSPKGVPAVQVLWAQTSLKPVSVNSEEPDIEVETE
VPEVLKTEPLEDFGNLRPPTPTGSLADSDLDVRLKSKFSSPTVEDEEGLPRTPGREAAAL
LDVEVPVTKLPLLCSGPPPTIEIETQAPLLPPGPLPELPIAPKLPMEEELPRTPGRDFVS
KAAKCLGKSQSTDTVPNTPGSDAPLTGNSLTLSSPHIPGSPFSYPSQSPGASGGIPRTPG
RDFTFTPTFPEPSIAASAAQPGLHGKSSSDSLEDRLLFKEPTIASPLNSMIPPAAFPCPL
PAGSLKDFELPSPGACPPLATPPLNTAIVPNEQPIGRPEDLTLPPDVTPPKRKPGRPKTK
KTSPALSQSLEDQEPKVAAEVLPSLPRDLPVTDLFGREMDAVAASAAAAIAAAGVRDPSA
VSLDFREEWEETEVAPQDKMPLKELENKLPEDVLDQQEEQVLKPRRHRRKQEELLLAMHS
PVASPHRPTFYPRSEFEEMTILYNIWNEGIDEEDIRHLQITYDKMLQQDNGMDWLNDTLW
VYHPPTCVPDVKKKKRDDGMRDHVTGCARSEGYYKIDKKDKVKYLNSSHPVTDEPPVDTQ
GLSIPAQPHASTRAGSERRSEQRRLLSSFSCDSDLLKFNQLKFRKKKIRFCKSHIHDWGL
FAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFA
RFINHSCNPNCYAKVITVESQKKIVIYSRQPINVNEEITYDYKFPIEDEKIPCLCGAENC
RGTLN
Download sequence
Identical sequences W5MD08
ENSLOCP00000006267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]