SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000006346 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000006346
Domain Number 1 Region: 581-643,815-934
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-40
Family Ypt/Rab-GAP domain of gyp1p 0.006
Further Details:      
 
Domain Number 2 Region: 6-73,106-182
Classification Level Classification E-value
Superfamily RUN domain-like 4.71e-25
Family RUN domain 0.0028
Further Details:      
 
Domain Number 3 Region: 910-1033
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.8e-25
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000006346   Gene: ENSLOCG00000005260   Transcript: ENSLOCT00000006354
Sequence length 1041
Comment pep:known_by_projection chromosome:LepOcu1:LG22:8215190:8276464:1 gene:ENSLOCG00000005260 transcript:ENSLOCT00000006354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEAVTKKFVHEDSSHIIALCSTVEACLLHMLKRRAAGFLRSDKVAALFTKIGKVDDTTA
EVCRKVQGQLQQQQQQVEASRRAQSSSPESLKRQSSTAGRPPQPLSPQAIKHIWVRTALF
EKVLDKIVQYIVDNCSKYYEKEALMHDAVFGPILAALLVGPCALEYTKLKTSDHFWTDPS
ANELVQRHRIHGAHSRPDSSPGRRPTLGVRKRQSSGSMSEDKFAASAREYVESLHQNSRT
HLLYGKNNVLVQPKEDMEVLRGYLSLHQAAENLTLKWTPNQLINGTLGDCDLEKSIYWDY
ALTVPLRQIVCIHCHQRPDCGGTLVLVSQDGIQRPPLHFPPGGHLLAFLSCLESGLLPRG
QLEPPLWSQRGKGKVFPKLRRRNSTTRLGEPRDTGGEEEIAADYVFRIVYPGHRHESTRA
VTINYHHVTGSRAPSLDEDEEEEDRLHAMISMICSRNLTAPNVMKDPGDMIEMQGFGSSP
LSWQQGESGSHVSSCLSCSTGGSSTPYELHPGCTCIHDRIPLKMLCQNMKKQIVSRAFYG
WLAYCRHLSTVRTHLSALVNHNIVPPDKPCEASGGLSKDVWSKYQKDCKNYKELELLRLV
YYGGVEHKIRKEVWPFLLGHYKFGMGKKEMTQIDEKVAAKYQQVMEEWKACEVIVKQREK
ETHSAIFAKFSSGSSIDSHVQRLVHRDSTISNEVFMSVEELDSRGRGLQGQEDGTTTLTN
VGTPVVLAPDERPLVEFDSPDSGLPSSRNYSVASGHSQIMSSIEDAQSMEEEPGEEGAQS
MLGEQGRQDSLSEEQLCGQVDRLMTGPGGAPLSLSSYTIELLDTVALNLHRIDKDVQRCD
RNYYYFTQANLEKLRNIMCSYVWEHLEMGYVQGMCDLLAPLMVILDDECLAYSCFTQLMK
KMSQNFPNGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLY
EDLFEAWEVIWAARHISSEHFVLFMALALVEVYREIILDNNMDFTDIIKFFNEMAERHDV
QQILRLARELVHKVQTLIENK
Download sequence
Identical sequences W5MD87
ENSLOCP00000006346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]