SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000006935 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000006935
Domain Number 1 Region: 512-612
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-25
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000006935
Domain Number - Region: 136-266,512-532
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00136
Family BAR domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000006935   Gene: ENSLOCG00000005741   Transcript: ENSLOCT00000006943
Sequence length 618
Comment pep:known_by_projection chromosome:LepOcu1:LG24:4021163:4037769:1 gene:ENSLOCG00000005741 transcript:ENSLOCT00000006943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQHNMNTSGNPLQIGSPLVMPTQVARSSGSASSPSSGEETDSETENSREDPAPVHPAEV
EHTQDAALVSRLQRRIKDMDQQREELKLEMQMERALLEGELQTEQEELTKETQRLDTLQE
ALRQQEMRFHSERQQEKMRLQAERQRVDELRQRQEEFQRQVETQPESLREQLRQRLQEER
EALDGEVRAFEDLEFHFLERESVLEEERESAHRKALQDISQQQHRVNSIKQERVIQLRDQ
VRQVQKQSDKELQRLSQGRKDLLKCLHMHLLKDKKQLSDLGHLAGSAPCMLSLSPLSIHR
PGQDMNAMSSLQKRRSSDKNCKPPDRPVSVHGRLLTTMDSYPQPTCPPEVTVSELHSTDT
SKSPPSSPLSQANGFLSCNGSITLNNSVTTSQASSPGQGLPNIEEIERKLREAKAERERL
LRVREEAKKRAEEEARQKELESSPPPSPESELSSLGSSVEETETARLFSRCQASPPPFRS
LISCEAFDLRGHLEALGHGVETCQPVAVTHRKCKGFLTKMGGKIKTWKKRWFVFDGEKKR
LAYFADKEETKLKGVIYFQAIEEVYYDHLRSASKSPHPKLTFCVKTYDRLFFMVAPTAEA
MRIWMDVIVTATDEHGRY
Download sequence
Identical sequences W5MEX6
ENSLOCP00000006935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]