SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000007220 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000007220
Domain Number 1 Region: 24-285
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.68e-47
Family Protein kinases, catalytic subunit 0.00038
Further Details:      
 
Domain Number 2 Region: 451-523
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000471
Family Caspase recruitment domain, CARD 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000007220   Gene: ENSLOCG00000005977   Transcript: ENSLOCT00000007228
Sequence length 539
Comment pep:novel chromosome:LepOcu1:LG23:12490661:12505309:1 gene:ENSLOCG00000005977 transcript:ENSLOCT00000007228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQHSFLPTIPEQDVVKVVLTPTSSGSCLKGSYSRTGRQVCIKVLSVHRPAEREWSEQFQ
EIEQVRRIRSDRVLAPLGVYKTHHFLGLVSEWMSGGSLHTLLNERQRYPELTVPLLLRIL
LDVAEGLSHLHGIPLSHQALKPNNILLDAQYRAKVCDYGLLQWKKWNLKSVRDDCNGHWI
RDLVYLSPEVLRGETPAIEGDLYSFGMVMWETLNRRQAYEGIGQPRALPLSVQSGMGPGI
GEEAVAAGVPQCRALSQLMALCWSRDPASRPRATDCLLVLRSAIEAFHPDSIAGAVLQLN
ESKERALLYGKDQSFQELQVEIHNLETSGCCGDSKHPGNKTVLLEKVQTLSSASQRTRPQ
NQSSPPSAQGSPPTACHRECWIPACTSLLKPPCQSAQASLPQGPSRRGETRCSPPPKMNP
PPFRAPVLPRNLPLERPRHCSVDSLPGKSCCQILQDRRESIVRGLTEGGLNKILDMLRSR
QLLTPEAYELVRAARTLADRTRSLLDTCVCLGERAAELLVVALGLVSASVSRSPAPLFQ
Download sequence
Identical sequences W5MFR1
ENSLOCP00000007220 XP_015223873.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]