SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000007964 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000007964
Domain Number 1 Region: 138-207
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000184
Family DEATH domain, DD 0.0049
Further Details:      
 
Domain Number 2 Region: 13-88
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000706
Family Caspase recruitment domain, CARD 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000007964   Gene: ENSLOCG00000006593   Transcript: ENSLOCT00000007974
Sequence length 225
Comment pep:known_by_projection chromosome:LepOcu1:LG4:16245137:16252094:-1 gene:ENSLOCG00000006593 transcript:ENSLOCT00000007974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPTPAGGRLRLRRWKPRLIEVLSSDPDFVLQHAQALSLLSDQEYRRIKALGDPSEKVR
DLLDCVLDKGQAPCSRLVELLQDRSVQDTYPRLSFLTEEPEEEQLGAVQTKAQLKRKIEE
VTSGAEEKPGDGVALVSERQLMQLASQVGHEWKQVGRLLLGLPSARLEHCAEENPHAHCE
RVFAMLRAWRTREKRGATAARLHALLSQDCSPLHPEAFDFLLEPS
Download sequence
Identical sequences W5MHV5
ENSLOCP00000007964 XP_015199801.1.81211 XP_015199802.1.81211 XP_015199803.1.81211 XP_015199804.1.81211 XP_015199805.1.81211 XP_015199806.1.81211 XP_015199807.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]