SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000008012 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000008012
Domain Number 1 Region: 12-240
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.74e-80
Family BAR domain 0.0000000166
Further Details:      
 
Domain Number 2 Region: 289-369
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-24
Family SH3-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000008012   Gene: ENSLOCG00000006631   Transcript: ENSLOCT00000008022
Sequence length 373
Comment pep:known_by_projection chromosome:LepOcu1:LG19:9622279:9633868:-1 gene:ENSLOCG00000006631 transcript:ENSLOCT00000008022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFYKASQMVSEKVGGAEGTKLDEEFKDLERKVDVTSKAVTEVISKTSEYLQP
NPASRAKLSMLNTVSKIRGQVKSPGYPQAEGLLGECMVKYGRELGEDTNFGGALLDAGES
MKRLAEVKDSLDIDVKQNFIDPLQGLCDKDLREIQHHLKKLEGRRLDYDYKKKRQGKIPD
EEVRQALDKFHESKEVAETSMYNLLETDIEQVSQLSALVEAQLQYHRQAVQILEELSEKL
RTSMSEASSRPRREYTPKPKPSLDYGDADQSNGGFYTPAAAAAPAARSSAWHQDFPGPVV
PLSLPPFPHTMDQPCCKALYDFEPENDGELGFREGDIITLTNQIDENWYEGMLHGQSGFF
PLNYVEVLVPLPH
Download sequence
Identical sequences W5MI03
ENSLOCP00000008012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]