SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000008047 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000008047
Domain Number 1 Region: 423-816
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.75e-135
Family Ankyrin repeat 0.000000000161
Further Details:      
 
Domain Number 2 Region: 65-441
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.14e-114
Family Ankyrin repeat 0.000000126
Further Details:      
 
Domain Number 3 Region: 3955-4063
Classification Level Classification E-value
Superfamily DEATH domain 6.77e-25
Family DEATH domain, DD 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000008047   Gene: ENSLOCG00000006646   Transcript: ENSLOCT00000008057
Sequence length 4475
Comment pep:known_by_projection chromosome:LepOcu1:LG5:10087560:10290963:-1 gene:ENSLOCG00000006646 transcript:ENSLOCT00000008057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTPIGGGESDTAQGGSSSLTTPEDKSDSNASYLRAARAGNLEKALDYLKAGVDINICN
QNGLNALHLASKEGHVEVVAELIKLGANVDAATKKGNTALHIASLAGQTEVVKELVTNGA
NVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSL
LLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVA
TLLLNRGAAVDFTARNDITPLHVASKRGNGNMVKLLLERGARIDAKTKDGLTPLHCGARS
GHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTAL
HVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIASKKNRIKVMELLLKHGASIQAVTE
SGLTPIHVAAFMGHENIVTQLTHHGASPNTTNVRGETALHMAARAGQAEVVKYLVQNGAQ
VEAKAKDDQTPLHIASRLGKADIVQQLLQHGASPDASTTSGYTPLHLAAREGHEDVASVL
LEQGASLSTTTKKGFTPLHVAAKYGKIEVANLLLQKKATPDAAGKSGLTPLHVAAHYDNQ
KVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADTNAITRQGISPVHLA
AQEGNVDVVSLLLARNANVNLGNKSGLTPLHLAAQEDRVNVAEVLVNQGATVDPQTKMGY
TPLHVACHYGNVKMVNFLLQHQAKVNAKTKNGYTPLHQAAQQGHTHIINILLQHGASPNE
LTVNGNTALAIARRLGYISVVDTLKVVTEETLTTTTVTEKHKMNVPETMNEVLDMSDDEV
RKANVPESLNEADYISDVEEGEDAMTGDTDKYLGPQDLKELGDDSLPQEGYMGFSIGARS
ASSDRSNTLNRSSFARDSIMIEEMLAPTKDTHLTVTREYDSDSLRRYSWAADTLDNVNLV
SSPIHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLASPPPM
VEGEGPASRLVEVGPAGAQFLGPVIVEIPHFGSMRGKERELIILRSENGETWKEHQYDCK
SEDLNEILNGMDEELDSAEDLEKKRICRIITKDFPQYFAVVSRIKQESNQMGPEGGVLSS
MTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPI
TMTIPVPPPSGEGVTNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVSDCVSFT
TNVSARLSFWLADCHQIPETVGLASQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMT
DDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLVSLTKAGQQLIFNFYAFKENR
LPFCVKVRDNSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKELESDQDEETEKP
ERRHTFASLALRKRYSYLAEPAMKTVERSTARTLPAGFAYKPVFSTRSYQAWSAAPITVP
GQGKSGFGSLSSSSSNTPSASPLKSVWSISSASPIKSTLGASTTSSVKSVSDVASPIRSF
RSISSPIKTVVQQTQYPLQVSTTLLSSPGKTAVAPDPTTVKGLASSLSSRTSPVTTAGSL
LERSSITMTPPASPKSTVNMYSSSLPFKSVIPSSAPVTSSPIKAIPALSSVKSTADGAGA
SKGKLVSSLSSPVKSAVTSTETALLNGSVSPIKYPSSSSTMLISGGTLQEKLHTTTHAAT
TCVNAAIEEVEKAFSSCASVYAPLKTMSSPTVMAYQSMRPPATSPMYASLRSPSSATTSV
TSATITVPVYSVVNVLPEPQLKKPPETTKSAAALLSPMKSTSTEAHTQTQSSFSRTLSPI
KSSLFISPAALKTATASSLSSSQEILKDVAEMKEDLIRMTAILQTDNSTAGKSFQSDPPK
EPKIEDEEPFRIVEKVKEDLVKVGEILKKDTFSENRESSRDNSPEDDWVEFSKDEIEEAQ
ENSMKRLLNYDTETVQARTKPVSDKDFNLARVVDYLTNDIGASALSKMSDIKYRYDEVKK
EGEEKQKRILKPAMALQEHKLKMPPSNMRSSASEKELCKLADAVFGTDAILESPDDFSQH
DQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHDVPIPPVITETRTEVVHVIRSYEP
SSDETQEPKLEEAGPSITPICLESDQKTNGSIKDKVKAFQMKVNSEEENHKAVVSKGMCV
KEETHITTTTRMVYHKPPCKETTSERIEETMSVRDIMKAFQSGRDPSKELAGLFEHKTTT
DSIKGSETMPRPVEKDIKPKPKVERIIEVHIEKGNKAEPTEVIIRETKKHPEKEMYVYQK
EHVQGDHSVKELPDRLDADDEVPQEEEELTAEESLPSYLESSRVNTPVSQEEDSRPSSAQ
LISDDSYKTLKLLSQHSVEYHDDELSELRGESYRFAEKMLLSEKLDISHSDTEDSVTEHP
HVLGSETQGAERYYREPMSSAPKKEFLLKSSKDASGNGAGKIAGSDEHYDKLTVLHYTAD
PSSPKHAVWMRFTEDRLDRNREKLIYEDRVDRTVKEAEEKLNEVSQFFRDKTEKLNDELQ
SPEKKPHRREPRETRSGPSSTSSSPEKVQFKDGASSEEWGKARLREQSVGKLFGSSNERK
CASLPNSPERRMLSQRTDDKGKQGDSAPQSKAGEGSQTLQLKPSKVSSVRLKFESEQFQQ
AQKQEKGPQWGQTKPPVKKLQESKLPVYQVFAGAKTPKLADNTDEGETPRRDVDSERGKA
APAPGPDTIRSQISSAAQKQSCDRVPRKAASESKQLTAQREKLTHTLVHDSLRDSGDSVH
GENDKQKVVSYQEKGQQPSKNGTPAKEVAMSFPSKKIIYTELVVREDSNNVDNDTRNRTL
KKKMEPSPSQIPVRMPSSVSDSDQSKTSKPETLIKPTERSGSQIPALAKNRFQASPETHS
YRDEMESSTSRSPDSLECSPIQDALSNDFGDPSPVEYMEKVAPFVKAENFKDIKTLPVYV
SIVQVGKQYEKETRGAFYTVKQKQPPSPQGSPEDDTLEQVSFMDSSGKSPLTPETPSSEE
VSYDLTSRTPDSLFAFIPGKPSPIPEVSEESEEEEQGKAFKESLPESNKPSNSVSTNENK
ESGKRTKDKRVAYIEFPPPPPLDSEQAEAEKTESRPSSETEVEMMEVNLQEEHDKHLLAE
PVIRVQPPSPLPPGAEDSDSSDDESVFQPIPFKKYTFKIPEDQEEQKSKARKQERNGNHK
ESGTNGAGKGDDFEFEQNGNDQSITDCSIATTAEFSHDTDATEIDSLDGYDLQDEDDGLS
EQDPKPYSLLADSKKDIWAAEGMLKPCDRSFSQTKLEVIEEEGKITNDEGKKAKPESESP
DKKMDEKKDGNGQNYTLEGRHPDRQGFADTYFSYKLEEEFATPFKTVATKGLDFDPWSSK
GGDDEVFDTRIKDEEPKPFGLAVEDRSQATTPDTTPARTPTDESTPTSEPNPFPFHEGKM
FEMTRSGAIDMSKRDFVEERLQFFQIGEHTSEGKSGEKGEGVKKSGVVTSELTPVEKTIE
IKVEAPADTKAAECDLTQANAHCVDASSGDDVADTSPCSITASKVDCKLRTPIKMGIAAS
ITVKKESGAVEVTDCKAETLDSQILENRDKVAHTGAKPRRNTDISRSPERIGYPKDNFNN
NNNLDSSNIQTAYIQCNSIVFNLQSAPESSVQNDSKTDALFHRELDKLNENSMQGEQTRE
SSKSLESETKQPKSRLPIKASKPTPHMQSTAQKAGKQKLKHVSKMEARKRADPSATLEPR
SRIPIKGISKSNVSPPITVQIVTRSGKVEKERVKQIPSRLPVKDRTSNSSPPASKTGRDH
LSEVCKRSIEYFKNISGETLKLVDRLSDEEKKMQSELSDDEDSTSRNASLSEAAQVCQPS
ITSRSARDLKTEAAPLKSKVEKANSERRRSRRTDGNEGSQVSGPHVAHIVEIKPSPQSPC
DRTDLRMAIVADHLGLSWTELAREMNFSVDEINQIRVENPNSLTTQSFMLLKKWVSRDGK
NATTDALTAVLTKINRMDIVTLLEGPIFDYGNISGTRSFADDSAVFLDQADGYNNIQMEL
QTPTELRYEPPTPLRNDDFFSDVPSVDSPFRNPCRPSNLSLSQQLQSSSAATKPPKVTAE
DTSLDDHRLERWTVPGESRDETQACEQEEETDTSPESVTPPAQEDKGVVKEQEGSWQPGA
RASVPYHGVTAEEEGSQSGSEEEEEMMQEQLEDIWSEGKEMPEESVQANLKQVQQAETDM
SPIPGWHSETSSVNVEPPTPGRSLSQEQSSDSITSSSKEQPGKPKQNGEHVEFPSPTGTV
PLAQEPASGAKDGRAGPSFQEEDSYTSEHKVQEHRDSESSSDEERTVTTRVIRRRVILKG
EQAKNIPGESVTEEQFTDEDGNIITRKVIRKVIRRVVASEDKDREKGKKDENSKQPLSLE
EECFKHSERQTVKEHGEGHKMKKKEVRHTEKKIHS
Download sequence
Identical sequences W5MI38
ENSLOCP00000008047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]