SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000008534 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000008534
Domain Number 1 Region: 617-828
Classification Level Classification E-value
Superfamily RNI-like 3.25e-34
Family 28-residue LRR 0.0028
Further Details:      
 
Domain Number 2 Region: 10-88
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000151
Family Caspase recruitment domain, CARD 0.0021
Further Details:      
 
Domain Number 3 Region: 163-343
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000215
Family Nitrogenase iron protein-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000008534   Gene: ENSLOCG00000007052   Transcript: ENSLOCT00000008544
Sequence length 841
Comment pep:known_by_projection chromosome:LepOcu1:LG22:11395026:11402679:-1 gene:ENSLOCG00000007052 transcript:ENSLOCT00000008544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGPCSLQLQERRPELVEMWSRCISEVLDLLHEEQVITTEDVSFVRGDHLGKTDQMRNL
LDVLHGRGEESCRAFVDMLERKRHLLLQARMQPQQQHSQVHKKILGSQHGTVVDYIGKSR
PGQPLEESYTEITLSLNETFTVRGQHEVTEVGNAFKKLDSERRCEFETISKNLLQQDMVT
AVLCGVAGSGKTTVTKRFVQYWSKDSLTSKIVFIFTFRELNLITECRSLQELLSTHYSHL
KPILNQVFSKDPSRILFIFDGLDEFQFPLDFDKTPKCTDPEMPQRINHMVVNLLKGNLLH
GCSMLITSRPHAVSKLPQALIQNFYKILGFSALQQKEYFRKSCGTPEAADEIWQYVSARP
PLFLMCHIPAFCWIIVTALQEKISVTAGTENTITVTEIYCRFLKAILVFHGEQKDGSQIQ
KLLKAQQLLRTMRPRLKDLGALAFKGLVERRFIFGPGDLTWFALDQNDLSKMFLVEILKE
DRDFLAYEKSYHFVHTSLQEFFAALYYVLESQTGMDPFSCLKSALLPVHRRLAAGMRKLF
GPERVLRKRVKEAFNWSHRHQSGHMDLFCRFVSGLLVPRTRQILEGIFAPPGGAHPQLFL
LRLLHKQLDSSSLVPERQVNVCHCLYEAQDPGMMDRLKSWLAHVSQGQAQNSPRDWTELA
FLLQLANNLDELNLENRGLGADGLRRLLPVLPFFSTLRLGQNPLGSEGAAVLATVLKSPD
CRIERLWVVGAGLGSEGVKMLSEGLKENSTVVDLRLAINNIGDDGAGCLADVLMRNRTLK
DIRLRDNLITDKGAELFMAALRENTTLEYLWLFDNKISKAGVRRLKDFAKTRESLDIKSC
T
Download sequence
Identical sequences W5MJH5
ENSLOCP00000008534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]