SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000008546 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000008546
Domain Number 1 Region: 1075-1208
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-21
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000008546   Gene: ENSLOCG00000007059   Transcript: ENSLOCT00000008556
Sequence length 1217
Comment pep:known_by_projection chromosome:LepOcu1:LG11:21265650:21287796:1 gene:ENSLOCG00000007059 transcript:ENSLOCT00000008556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFTEKLLERTRARRENLQKKMAERPTAANRLIAKRARDPLTETNILPEQPAEAVQPST
KPSPSKRRCSDNKEAPATGEENREPVIQEAVPKTAETDRKPAVASLSSSARPAPEFDKKE
EEIPAHSTRSIKSRMQKLVDQRQYWDNEGDAVDNGYISSIKPQRQDPSPPKQPLVSGSSE
TPAGRKGRFANLAATIGSWEDDLSHPSVKRNNAQAQPGTTCLSKPSATNGASACASSASV
KPSTASYSQKTAEASLNKPVLSGEQSSVHLPVQSTRVVPPNPQKAETPEPRSVLPTNRNI
PSSPQKTTRLTTQSASNTGRLISSPQKINLPSHQAALPPRSVFSPSPKKPELSKAQASGE
IGRFNSQSPQKSQPPKELPAFQAGKVSPNVRKTEVNSTPQAKATSSAPLTREQLVKDGSL
QQPKNTAVTPGGSGVKSFLERFGERCQERTVQSPPYSAQGHRTPAVTPNTKQVQERLKSH
QSGTATADLAQKQKQERERELASIRNRFQKGSMWKSDKNESSDTKDLPSSSGIAYEPLGQ
PRDTPQSESKPASHPEDVTPTSSSLKSSGTSLNSLKEDAIVSSSSTSSPLKKVAFTEEEK
NLPEPLEDKREKQDISAGNQEIEMNVDEEINSAGVIDELFDEEDDNEQRPRSPLAKLPGQ
DRLEDEEEQDVEDDEDPLNISSMSLLTPLAETVASVVTSPEASTPTSTAREKGKTPEGKR
PTRYQRARVHRAESIESVDSVADDQNLLYSIDAYRSTRIKEVDRPHVKQVIVRKEDVSQK
LEENRSVGQVNIKQKMKFFNNEINMQQTVIHQASQALNCCVDEEHGKGSQVEAEAERLLL
IATERRAALLKELNKLKGEGPSAQKKTPSTCKAQDASCSASKGSISLFELRLPLKADFVC
SAHKPESANYYFFIMIRAGAENTVATPLACTQNALSGDALSFPTKFTLSDVSNDFEIDVE
IYCLVQKRELPSDKRKKANKSKAITPKRLLTSITKSSLQTPVMASPGGPNAVRTSSFALV
GSHKLTLTSIGKNKFVLDKMKYEGNDKQLLGDMFQYKVPFLCPLEGHIYLKLQCQVGSSI
EERGFLTMFEDVSGFGAWHRRWCVLSGYCISYWTYPDDEKRKNPIGRINLANCTSRKIEP
ANREFCARPNTFELITVRPQREEDKETLVSQCRNTLCVTKNWLSADTKDERNLWMQKLNQ
VLVDLRMWQPDSCYRPT
Download sequence
Identical sequences W5MJI7
XP_015213015.1.81211 ENSLOCP00000008546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]