SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000008819 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000008819
Domain Number 1 Region: 96-162
Classification Level Classification E-value
Superfamily Virus ectodomain 0.0000000000003
Family Virus ectodomain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000008819   Gene: ENSLOCG00000007287   Transcript: ENSLOCT00000008830
Sequence length 229
Comment pep:novel chromosome:LepOcu1:LG2:21252738:21253833:-1 gene:ENSLOCG00000007287 transcript:ENSLOCT00000008830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YWQCGAKVYHSLPPQWRGVCAVVMLHHSILIVPVNSYLLNSMKPLQRESRVKHALSWADR
YGPDISKIPEDNRLPFFLSEMIFSSGLSIQLQITRYEMYSFINITLEGLDAIKQELRGVR
LMALQNRFMLDLQNAASGGVCALVEDSCCTHIPENDDDYGNLTLAIQHLKELKDKVNKER
GIKDTPAFLYCLESLFGQGGMFFFKLLTPIIGAVILVFLFLCCCMTWII
Download sequence
Identical sequences W5MKB0
ENSLOCP00000008819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]