SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000009309 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000009309
Domain Number 1 Region: 158-257
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.71e-34
Family Ras-binding domain, RBD 0.0018
Further Details:      
 
Domain Number 2 Region: 298-411
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-17
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000009309
Domain Number - Region: 90-95
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0366
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000009309   Gene: ENSLOCG00000007664   Transcript: ENSLOCT00000009320
Sequence length 609
Comment pep:known_by_projection chromosome:LepOcu1:LG9:16109387:16155055:-1 gene:ENSLOCG00000007664 transcript:ENSLOCT00000009320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDIDAMFSDLLGEMDLLTASLGVETVPPQSPSSSHKEVNFSIGFKDLNESLNALEDNDL
DALMADLVADINETEENLTGQRQASHGSLPPPPPPEQQHRSAASAPSSFPPPPHSLPAAR
PPGPSSQPLPPPEPPKQLTKEEIEVQAKADKIKLALEKLKEAKVKKLVIKVIMTDGSSKT
LMVDETQTVRDILDNLFEKTHCDCNTDWCLYECNPDLQIERSFEDHENVVELLSQWTRDS
ENKILFLERKDKYAVFKNPQDFYLGNKGKKNEQREMKDKDKESLLEESFCGTSIIVPDLE
GALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFDNVNIYYGTEYKVKY
KAPTDYCFVLKHPQIQKESQYIKYLCCDDKYMMHQWVTAIRIAKYGKTLYDNYKVAVQRA
GLASRWSNLAAANTTKSSGPPRAKVAIEANGHAAQAPAHTTLSKAFPEAWKRAEAKDNAR
DGANDPSSLPPPPEEFLPPPPPDPVLPPPPQPCLIAAPRMAPPHGQPICFPPPPPAEDQS
LPPPPDDLPEPPPDFLPPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPLQR
PVLPLPPEK
Download sequence
Identical sequences W5MLQ0
ENSLOCP00000009309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]