SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000009411 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000009411
Domain Number 1 Region: 391-715
Classification Level Classification E-value
Superfamily DNase I-like 1.7e-56
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00013
Further Details:      
 
Domain Number 2 Region: 14-112
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-28
Family SH2 domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1216-1282
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.19e-17
Family SAM (sterile alpha motif) domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000009411   Gene: ENSLOCG00000007744   Transcript: ENSLOCT00000009422
Sequence length 1284
Comment pep:known_by_projection chromosome:LepOcu1:LG3:12606037:12656285:-1 gene:ENSLOCG00000007744 transcript:ENSLOCT00000009422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLSPLGSAAPLWYHRDLSRAAAEELLARAGRDGSFLVRDSESVSGAYALCVLFQKHVH
TYRILPDEEGFLAVQTSQGVQPKRFKTLPELIQLYLQPNQGLVSTLLYPVEREESLEDRD
YSDGEDDKPPLPPRTASTSSPASSSSAVVPAGQDLQIDSASNGLSTISHEYLKGSYALDL
EAVKQGASSLPHLNKTLVASCKRLHGEVDKVLAGLEILSKVFDQQSALMVSRMIQQSGSQ
GGDQDLDSLVTKLSILKDLLSSIEKKKPLKGLCGRGCNFVGGGPGLTLRRLVVLLTCQVK
LDVNLADLTKIGKSQKHTLSVDVEGGKLVVMKKVKDSQEDWNTFTHDKIRQLIKSQRVQN
KLGIVFEKEKDKSQRKDFIFASAKKREAFCQLLQLMKNKHSNQDEPDMISIFIGTWNMGS
VPPPKSMSSWILSRGLGKTLDEMTVTIPHDIYVFGTQENSVCDKEWVETLRGVLKECTEM
DFKPIAIQTLWNIKIAVLVKPEHENRISHVGMSSVKTGIANTLGNKGAVGVSFMFNGTSF
GFVNCHLTSGNEKVARRNQNYLDILRLLSLGDKQLSSFDISLKFTHLFWFGDLNYRLDMD
IQEILNYINRKEFDPLLKVDQLNLEREKNKVFLRFAEDEISYPPTYRYERGSRDTYVWQK
QKATGMRTNVPSWCDRILWKSYPETHIVCNSYGCTDEIVTSDHSPVFATFEVGVTSQFVS
KKGLPKSSEQAYIEFENIEAIVKTASRTKFFIEFYSTCLEEFKKSYENDTQSSDNVNFLR
VGWSSKQLTTLKPILSEIEYLQDQHLLLTVKSLDGYESYGECVIALKSMIGSTAQQFHTY
LSHRGEETGNIRGSMRVRVPSERVGTRERLYEWISVDKDETGGLKGKQSSSRGSHDYVNP
CLSCCRQSVRKHQPNEPLGKVNEENERNPSHAAGRPSFPLPSTPKEEATQTRTKQDSVEA
DPSNSRNSYNNPAYYILEGVPNQSAALSPELTPGSALPPTGSKGATSGKVKPPCGGSIQP
RRQTSGRPPRPVSEEGSSEEDGTHGALGGTLNRPPPDFPPPPLPKGAVEMTENPFYASSK
DIKTRNLYPDLADIKIPAHTKPLHSPGYPPAVPSGSVSTFGLDPSPSLASAPFRRGGGAS
GLDDQSCSVLQMAKTLSEVEYQPGRDRNPPVPHKAVGPPLRGMGLPDSCRTFPPRSIHES
IAEDLPEEGCWQGGSSSSSLSVESSVGEWLQRLGLERYEEGLLHNGWDDLEFLSDITEED
LEEAGVLDPAHKKILLESLKQQQK
Download sequence
Identical sequences W5MM02
ENSLOCP00000009411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]