SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000009658 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000009658
Domain Number 1 Region: 17-172
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 6.28e-50
Family TRADD, N-terminal domain 0.0000977
Further Details:      
 
Domain Number 2 Region: 207-299
Classification Level Classification E-value
Superfamily DEATH domain 6.12e-16
Family DEATH domain, DD 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000009658   Gene: ENSLOCG00000007950   Transcript: ENSLOCT00000009669
Sequence length 304
Comment pep:known_by_projection chromosome:LepOcu1:LG23:16351993:16356639:-1 gene:ENSLOCG00000007950 transcript:ENSLOCT00000009669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METMEEKKVMSDCAAGVWSGSLFLFLCSCSREEDLTALFRDPEKRFAVFKAVKLTLSDAA
GGLEGYEILKLHDAQPSLGIQIKFMDEGVCRKFLQSYASGLVQQFFGQHLSRTLSGLKEP
TFETQLKAGSETLDNCLPDVDLCLHHVNRAQPDRLQDEEVSELEQQLQSLVLGDREPPSS
AQPLVSVGGDTQLPSNSFLFQNRMFGDRQLTTADQQGFASHIGKDWKKVGRSLQRSCKAL
KGSAIDNLAYEYERDGLYEQAYQLLSKFIQAEGKAAKLSRLIRALEENKLIGIAEILLDV
QPQE
Download sequence
Identical sequences W5MMP9
XP_015224118.1.81211 XP_015224119.1.81211 ENSLOCP00000009658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]