SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000009888 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000009888
Domain Number 1 Region: 116-195
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-24
Family Necap1 N-terminal domain-like 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000009888   Gene: ENSLOCG00000008144   Transcript: ENSLOCT00000009900
Sequence length 238
Comment pep:known_by_projection chromosome:LepOcu1:LG26:13207775:13211807:-1 gene:ENSLOCG00000008144 transcript:ENSLOCT00000009900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQSAHAAPPFSPLIGPHAGHVCRTQGVSPHLLASGRVLTSPPPPQPAQRAGRDARRRAP
APPAHRGASPPVPRLQGPGRGQTALLLYTARYGTGAAISHTRAGSRQRPVSKMASEPDYE
SILLVKPDINVYRIPPRASNRGYRAADWKLEQPDWVGRLRITARGKVAYIKLEDKVSGEL
FAQAPVEQYPGITVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDRPADPLTR
Download sequence
Identical sequences W5MNC9
ENSLOCP00000009888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]