SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000010010 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000010010
Domain Number 1 Region: 52-194
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000002
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000010010   Gene: ENSLOCG00000008242   Transcript: ENSLOCT00000010022
Sequence length 217
Comment pep:known_by_projection chromosome:LepOcu1:LG14:15938852:15956203:1 gene:ENSLOCG00000008242 transcript:ENSLOCT00000010022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IWSREEEPPKHFQTMLKTKLNVLTLKKEPLPTVIFHEPEAIELCSTTPLMKNRTHTGYKV
TYLGKVTIRGTQFLSGCTEPAVIGLWERRATAQEDTRPANAVLEIRPFQVRLHHLDGRGE
ATVHMDTYQVARIAYCTADHHVSPNIFAWIYREINDDLTFQMDCHAVECENKLEAKKLAH
AMMEAFRKTFNSMKNDGRIHKSSSSDEFPQEFAADDG
Download sequence
Identical sequences W5MNQ1
ENSLOCP00000010010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]