SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000010183 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000010183
Domain Number 1 Region: 182-450
Classification Level Classification E-value
Superfamily Caspase-like 8.52e-80
Family Caspase catalytic domain 0.0000000652
Further Details:      
 
Domain Number 2 Region: 7-97
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-24
Family Caspase recruitment domain, CARD 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000010183   Gene: ENSLOCG00000008375   Transcript: ENSLOCT00000010195
Sequence length 455
Comment pep:known_by_projection chromosome:LepOcu1:LG26:13652116:13659078:1 gene:ENSLOCG00000008375 transcript:ENSLOCT00000010195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSPCGMLPYHREALRRCSVALCKDLVIDELVQHLLSDSILTESMAESIMADKTSFQRNR
ALLSLLPKRGPQAFESFCTALRETEQQHLESMLRDRAERQRGAVSGAGGAEKRLSPCGDN
CTNRLAVISQGRGVLTEKCGDFPLPLPTQEDTMKAKRARTQETMEYCLDADGPTHMGVLA
CAEDFYFKHCQQSYKMTSRPRGLALVISNVDFQPVTPDLEPRAGGEVDEETLSRLFTELG
FRVTLHRNQTAQEVRASLEQFSQSSELRAVDSSVVCLLSHGVEGAVYGTDGQLVELDWVL
EYFDNAHCPQLQNKPKMFFIQACRGEDTDSGVDQSDGPERTSSPGCEQGDAAKEVVKVKL
PQRSDMICGFASLKGTAAMRNTRRGSWFIQEMSSVFRQRARDKHLADLLVEVNARIKQRE
GFAPGTPFHRCKEMSEFTSSLCKDLYLFPGYHPKQ
Download sequence
Identical sequences W5MP74
ENSLOCP00000010183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]