SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000010343 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000010343
Domain Number 1 Region: 12-179
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000000288
Family RUN domain 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000010343
Domain Number - Region: 821-852
Classification Level Classification E-value
Superfamily AhpD-like 0.0306
Family Atu0492-like 0.069
Further Details:      
 
Domain Number - Region: 682-700,857-899
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0963
Family Cytochrome c3-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000010343   Gene: ENSLOCG00000008501   Transcript: ENSLOCT00000010356
Sequence length 928
Comment pep:known_by_projection chromosome:LepOcu1:LG14:16369934:16388910:1 gene:ENSLOCG00000008501 transcript:ENSLOCT00000010356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIQEAEAGDRRREHWKLLYSLKTTVEGLLSTNNPNVWSRYGGLQRLHKDMNNILSHGLK
HDQIYPKVHRHYIFCWDLVQHIVPCAVREVIPFAVVATAVKTPVSTLQEWAPVMSGQWKL
KDGANLIALMLIHYGCHLDNVRKWCDKGAFLLSEPHVSAMFQCLEAVEQNDPRLLALIDT
GRLSHLQQTPLCLLKTQGLCALPGLRDREMSCPPHIKVPQRHNATNSTLMEKSVSGAPWM
CGVGQQDSASTPLGPPMVPHISLTEPSSPAWIGEGGEGVEAGEADFDDGPEYLAIGNLGQ
RRRRGSANNSTTSDQVEGSVARRCPLATSPRRSSFSEGQGPDRCGGAKQGHVRSLSDTGV
MQKRSNESRAEVCGAKEYSAFSPQSSEDSSPSSLYMESDGSQNSSVSDGMFRRPSEGQSL
ISYLSEQDFGSCADLEKENAHFSISESLIAAIELMKCNLRLRAEAEEEEESDSEIQQLKQ
KIRLRRQQIRKSRQQPAVQSQHTFPTSDSGDSQHSSQDSLHLSDSGSAEEVEECELRDGS
EGGSLLAVSRSGLSLSLASLFSAVRVRSQTQTLTHLLLYLSCSVSRLLENGATQGSSGVL
AQGYFMRLWIILQVDVLEPEHDAPQKLLPIPDSLPISPDDGEHADIYKLRIRVRGNLEWA
PPRPQIIFNIHPAPKRKVVVAKQNYRCAGCGTRVDPDYIKRLRYCEYLGRYFCQCCHENS
QAVVPGRVLRRWDFSKQPVSNFARDLLGKIAGDPLFNLQDINSALYRKVKALEQVRLLRL
QLFHMKNMFKTCRLAKEVLNQFDLVPGHLTEDLHLFSLNDLSAVRSGDLPPRLRELLRLG
STHVSGCMLCQAKGFVCEFCGNDKDIIFPFELNKCRRCEDCKACYHRACFRGERPCPKCQ
RLAERRERLARRNMEELQDEGEDEGGGK
Download sequence
Identical sequences W5MPN4
ENSLOCP00000010343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]