SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000010448 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000010448
Domain Number 1 Region: 471-581
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 287-410
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-16
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 588-654
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000144
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 4 Region: 647-709
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 5 Region: 714-774
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000144
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 233-296
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000751
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 118-234
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000968
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 8 Region: 410-474
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000123
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000010448   Gene: ENSLOCG00000008591   Transcript: ENSLOCT00000010462
Sequence length 871
Comment pep:known_by_projection chromosome:LepOcu1:LG20:14595175:14604908:1 gene:ENSLOCG00000008591 transcript:ENSLOCT00000010462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QELLESVLAERDFLLSKKGAAFPTALPGDLNPKRILAEVGRRGGILSSKQISAARKRLRP
HETSAAPQLLTPGPTDREPTRASVSQWHFTTGTPMPSVPSLLTADIPPTLTPGNEIAVSR
CSVGFSDPEGHIDSSDDPPPPSGSLLECTYTVTVYTGYGVKNKVKSVNLSEGEQLSIRGV
DEGGVLLVLANETLLVEGQVIRSPTNTISVFFRTFPEGGVGTFQLHYQIFRLSCALPRRP
HHGDVSVLDLHAGGMAKFRCHLGYHLQGEPQLTCLNASRPHWSSHEPTCRALCGGAVQNA
TVGRVLSPSPSTSTNDSTAISCSWTLEAPAGQRLHLHLERLALGPTDRLVLWSGLDAGSV
VLFDSGRGGPIPFEGVISEGPAVRVQFTSDLPQPPGGFNIRYEAFERGHCYEPYLQNGNF
TTSDPGYGVGAVVQFSCAPGHSLEQGPPVIECVNDRDPYWNDTEPLCKALCGGDLSGPSG
VILSPNWPDAYGEGEDCSWRIHVDEDRRILLDVQLLNLSDSDIVTILDGDEVTTRILGQY
IGGTSPFKLSSSTPDLTIQFHSDPAGLLFGKGEGFIINYMEVSRNDSCSDLPEIQNGWKT
TSHAALVRGARITYQCDPGYDLVGRETLTCQWDLSWSSQPPFCEKIMYCSDPGHVEHATR
TLSDPKLLVGTTIQYTCNPGYVLQGGAILTCYGREPGTPVWTSRLPRCVSEESVSCENPG
LPENGYQILYKRLYLPGESLTFMCYQGYELIGEIAIKCILGNPSYWSGPLPLCRASQDCF
DNHALEVAEAAADSSLDGGNMALAIFILVLLLSVLLGGAYVYVTRCRYHSHLRLPLMYTH
PYSQITVETEFDNPIYETGGLQDTREYEVSI
Download sequence
Identical sequences W5MPY9
ENSLOCP00000010448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]