SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000010590 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000010590
Domain Number 1 Region: 2163-2322
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.85e-32
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00083
Further Details:      
 
Domain Number 2 Region: 2932-2990
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000144
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 3 Region: 3682-3739
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000017
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 4 Region: 3089-3147
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000392
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 5 Region: 3913-3972
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000876
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 6 Region: 3287-3338
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000144
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 7 Region: 4112-4169
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000196
Family TSP-1 type 1 repeat 0.00041
Further Details:      
 
Domain Number 8 Region: 2642-2699
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000209
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 9 Region: 3743-3787
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000209
Family TSP-1 type 1 repeat 0.00069
Further Details:      
 
Domain Number 10 Region: 4869-4925
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000249
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 11 Region: 4053-4112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000536
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 12 Region: 1610-1647
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 13 Region: 1472-1510
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 2589-2642
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000115
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 15 Region: 4270-4322
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000116
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 16 Region: 2809-2860
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 17 Region: 4925-4985
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000162
Family BSTI 0.062
Further Details:      
 
Domain Number 18 Region: 2550-2588
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 19 Region: 1391-1428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 20 Region: 5036-5085
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 21 Region: 1785-1831
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000249
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 22 Region: 1352-1387
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 23 Region: 1901-1959
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000392
Family BSTI 0.063
Further Details:      
 
Domain Number 24 Region: 4365-4422
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000432
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 25 Region: 1252-1315
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000067
Family ATI-like 0.021
Further Details:      
 
Domain Number 26 Region: 2334-2372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 27 Region: 4819-4866
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000916
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 28 Region: 445-507
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000103
Family ATI-like 0.056
Further Details:      
 
Domain Number 29 Region: 3511-3559
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 30 Region: 1695-1730
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 31 Region: 802-863
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000164
Family ATI-like 0.02
Further Details:      
 
Domain Number 32 Region: 2488-2528
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 33 Region: 3046-3109
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000335
Family Fibronectin type I module 0.051
Further Details:      
 
Domain Number 34 Region: 3196-3250
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000343
Family ATI-like 0.047
Further Details:      
 
Domain Number 35 Region: 3444-3489
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000497
Family TSP-1 type 1 repeat 0.00095
Further Details:      
 
Domain Number 36 Region: 1428-1469
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 37 Region: 3149-3191
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000103
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 38 Region: 4173-4229
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000113
Family BSTI 0.058
Further Details:      
 
Domain Number 39 Region: 3240-3305
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000136
Family VWC domain 0.027
Further Details:      
 
Domain Number 40 Region: 2868-2933
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 41 Region: 1508-1545
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 42 Region: 4661-4714
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000693
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 43 Region: 1648-1683
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000864
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 44 Region: 1995-2053
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000144
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 45 Region: 1838-1881
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000262
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 46 Region: 854-921
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000314
Family VWC domain 0.041
Further Details:      
 
Domain Number 47 Region: 2725-2769
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000327
Family BSTI 0.089
Further Details:      
 
Domain Number 48 Region: 4475-4533
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000458
Family ATI-like 0.018
Further Details:      
 
Domain Number 49 Region: 2993-3053
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000834
Family BSTI 0.038
Further Details:      
 
Domain Number 50 Region: 902-956
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000278
Family ATI-like 0.083
Further Details:      
 
Domain Number 51 Region: 3401-3462
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000418
Family Fibronectin type I module 0.047
Further Details:      
 
Domain Number 52 Region: 5091-5152
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000507
Family ATI-like 0.025
Further Details:      
 
Domain Number 53 Region: 3992-4039
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000536
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 54 Region: 4423-4469
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000549
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 55 Region: 3792-3850
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000654
Family BSTI 0.062
Further Details:      
 
Domain Number 56 Region: 3568-3624
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000834
Family BSTI 0.039
Further Details:      
 
Domain Number 57 Region: 4725-4781
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000997
Family ATI-like 0.044
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000010590
Domain Number - Region: 3352-3403
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000124
Family BSTI 0.047
Further Details:      
 
Domain Number - Region: 954-1003
Classification Level Classification E-value
Superfamily FnI-like domain 0.00023
Family Fibronectin type I module 0.066
Further Details:      
 
Domain Number - Region: 505-545
Classification Level Classification E-value
Superfamily FnI-like domain 0.0009
Family Fibronectin type I module 0.05
Further Details:      
 
Domain Number - Region: 1742-1785
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00144
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number - Region: 2051-2114
Classification Level Classification E-value
Superfamily FnI-like domain 0.00534
Family Fibronectin type I module 0.084
Further Details:      
 
Domain Number - Region: 4793-4821
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0106
Family PMP inhibitors 0.0029
Further Details:      
 
Domain Number - Region: 4324-4378
Classification Level Classification E-value
Superfamily FnI-like domain 0.0115
Family VWC domain 0.026
Further Details:      
 
Domain Number - Region: 4239-4267
Classification Level Classification E-value
Superfamily PMP inhibitors 0.029
Family PMP inhibitors 0.0038
Further Details:      
 
Domain Number - Region: 3887-3916
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0746
Family PMP inhibitors 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000010590   Gene: ENSLOCG00000008668   Transcript: ENSLOCT00000010605
Sequence length 5315
Comment pep:known_by_projection chromosome:LepOcu1:LG9:19192223:19320018:-1 gene:ENSLOCG00000008668 transcript:ENSLOCT00000010605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHPSLIFCWLVSFTSLRHWCESKIQEREEKIVSPRLQKEVDCSRVYQYNLQGWRLDIDRM
RKDHGGDEGIAQYYQQNGPNASCYLYKPAQIETRLVNRTVWACCEGWGGPQCTQGIGVRG
QCYSTWSCQEFPGVHNSSLMPFEQCCTSLWGHSWRNNSDLSCLSCSYNLLSDSLSPLLLP
RAVLGSVRDPQGSSTCLTWGGAHYRTFDRRHYHFQGSCTYILSSSVDGTWAVYISTALRM
MFGLELLTAQEKNLSLNGMPLPQGQPLFQNGVSVRWLGDFVFVESGLGVRVKWDGDSTVY
LTVTAEHRSSTRGLCGVYNNNPDDDFTTVGGSMSQFAASFGNSWRVPDLQTEGCSDAAEL
GHSCDVTGDTELRRVAESLCHRLLEHPFSQCHSRVDPAAYVDTCLYLYCSQGQHEREQVT
CDTLASYARECAQQHVLITWRSAELCERVCSRGQVYSDCVSSCPPSCTSQHPPEAGQCRD
ECVGGCECPPGLFLEQGSCVRKEECPCYHRRHKYQPGDTIRQRCNTCVCQAGQWQCSGER
CPAQCTLLGELHITTFDGKRYTLQGGCAYTLVEDFVDSKLVVTMESGECARGGAQICLKE
ITVSAHRTTVTVTDTGEVMVNGQRETLPAVTGDLSVIRASSSFLLIQSFGAHLLWSLEGP
LALITLQPGFAHKVRGLCGTFTWSQQDDFTTPEGDVETSAAAFAAKFSTGLHCPPSRGHP
LDPCSTYTQRRQHAEEVCAVVHSSVFQPCHDLVDREPYHRLCLYEVCGCTPPRQCQCTVL
TAYARHCAQEGAPVNWRNQTYCPMQCSGGQVYQECGRPCQGSCADLRLTQGCPAEESCVP
GCNCSPGLAEDEAGQCVPTTMCPCVEGDLVYQPGSTIQKRCNTCVCQSGVWNCTTLSCLD
VVECPGSLVFSPHSCLRTCASLDVPGPCTEPLHGCVCPEGTVFLDDQCVSPAECPCHHNG
RLFYTNDTITKDCNTCVCSQRHWHCGRSLCAGVCIATGDPHYVSFDGRAFSFLGDCEYVL
VQDNQGLFILTAENVPCGTTGVTCTKAVTLTLGNTVIHLLRGQSVTVNGLPVSLPKSYSG
NGLRLEHAGLFISLSSSLGLTVLWDGGMRVYVRLAPEFRGQVAGLCGNFDGDAENDFATR
QGIIESTPELFGNSWRVSPSCPEVTSHNIHEPCIEHPHRATWSRKRCAIITQELFSPCHA
EVPCQQFYDWCVFDACGCDSGGDCECLCTAIAAYAEECNRRGIYIRWRSQELCPMQCDNG
LVYEACGPACTPTCGSLGQSPDPHCSALSCLEGCFCPHGTVWHDGSCISSLECPCEWQES
LYPPGATIIKDCQNCLCSAGIWHCEGQPCIPRPTCLESEFECGTGRCIPAPWLCDNEDDC
GDGSDEFCATTCAPGEFLCTNGHCLEGSLRCDGNPDCPDQSDEEFCPPIHPVCPLGQFSC
ANGRCLHPERVCDGHLDCGFADNSDEAECGLLCGNGEFQCSGGRCVPYTHRCDGHDDCGD
QSDERGCVCTLEELQCPGGQCVSPDRVCDGHEDCPSGTDEAICPSAGTVLSYQVFSQTAK
FNKLPQLMLMCVLFDGSDLWPWTVSDVTVETVTPRPWPAVTSMSPVSVPGGCGRYEFGCA
NGECTPLGWRCDGESDCADGSDEMGCHQVCGRSQFRCQNSGECVDHEHLCDGTPHCRDSS
DESLDNCGSTQIPPCPGSFLCDNRVCVNSSRVCNGVPDCPGGEDELTCVLYSFPPWSRNT
STILCPEYTCPDGSCLTFKQVCNGITECPSIALGQARGSSDEQDCGTWGAWEPWSPCSHT
CGTGTQRRRRHCHLQDSLRYCRGEDTQRQQCFSTACPVDGRWLPWTTWSNCSGDCTGMVV
RQRGCVPPQNGGETCADLPEQPAIAMEIKPCPQEGCPNVSSCPGDLTLRSCAPCPLTCAD
LASKDSCKSLTNCFSGCWCAEGLVMDSDQHCVRPEECPCEVRGVWYWPGQLMKIDCQICS
CEGGRPQHCRQNPECSVNCGWSSWSPWGECLGPCGVQSVQWSFRSPNNPSKHGNGRQCRG
IYRKARRCQTNPCEECEFHGQSYVIGEHWKIGMCQLCQCLPNLTVHCGPYCPLTAGCPQG
QVLVPGEGEKCCHCTGSGVNGTVSTLTPLVTPVIPSLNTVTTSSTESPAPHIPTYPLPPG
EECRGPLDVRSLPDSSFSASSEQLGHPPSEGRLNSQDSRRDLQGWSPEPDQYRALTTWTP
DDHADLAQPPYLQLDLLQPRNITGIITQGGGAFDTFVSSFYLQFSNDGQHWYTYQEVFLG
NSDDSSTAVTRLQRMVLSRFVRILPHDFHNAIYLRLELLGCGEGSSPSPLSPGPRGCLTS
QFSCPPSGPCIRVSQRCDGRMDCPDGADERGCTPSLDTSTPGTGGHRPAPTHSEHTVCSI
RRSKIKTLSKFKEIHNHLLLIILRYSKESLKQTLTGLLSKKITNPRKIQFLLKMNGWIMD
IKTLKSCVWHKDLFTVNVLYTGPGNVTAPRRRCGPGQFECSSGECVSAQTALCDGRQDCA
DHTDELGCGFTSRPPIPTVPVGPEIRPTPVPHPCSAKQFLCGTGECVHLDRRCDLQNDCQ
DGSDEKDCVDCVLSQWTQWSQCSVSCGLGSLFRQREVLREALPEGECGGTVFDSRACFTR
ACAVHGQWSEWTQWSNCDAQCSGGVRVRNRSCSNPPPKNSGRECEGGTVQTQSCNTHPCS
TPSGGETGCSAGMVLVKEADCLAGTVDPCPLTCSDLSTQSNCSSKCITGCRCPPGLYLQG
GHCVNASQCLCLWDGQLLQPGEQIRKGNCSQCTCQEGHVSCNDSQCEMRCDWTVWSSWAP
CDSSCGLGLQQRYRTPVIPVSVKVVPPCPGDSTEVRECHTPCETGPEPPGSQWSEWTSWS
VCSKTCFLHVDDVGRRKRFRSCNGTATNSTDITADDTCPGEAQHVQPCNTVPCPVSGGWS
PWSPWSLCSSECDSGVQTRQRSCSVPYPRYGGLHCPGPHIQTRECNTHPCRGACPEGMAY
QTAGECHAQGGACPRICLDLTPTVECATACYDGCYCSPGLYLLNDSCVPLSLCPCYHKGA
LYSPGTTVLWDSCNNCTCFDGEMSCGTEPCPVDCGWSSWTQWSTCSRTCDVGMRRRYRSG
TNPAPVFGGRACDGSMVEMDSCSLGPCQGVWGVWSPWSECSVLCGGGYRNRTRDSPKGQS
MEFASCNLQPCGNMSSCPAEQEWRECARGPVTCSDLRVEFNNRSCEPGCYCAQGQLLQDG
QCVPVSQCRCVVDGKQYLPGDTVTRDCNNCSCESGQLVNCTEFSCDVDGQWSVWTPWSGC
SVSCGPGLQTRYRFCSSPARSGSGLPCLGPDRQDQICLLTACDLPPCSEVPSTVFSSCGP
SCPRSCDDLAHCEWSCEPGCYCTGGKVLSDNGTSCVDREACPCLDVLTGQRLAPGESIPA
PDGCNTCTCERGRLTCTNRPCPAVSGGWCKWSSWTPCSRTCGAEWVTRYRSCTCPEPSGG
GAACPGEQEKHSGLGVQIQRQPCPSLTFCPVHGSWGSWGPWSECAVCEGTSVRVRECNSP
PARFGGLPCHGVARESRSCRDNSTICEDCGGGQVQLACGKPCPQSCSDLHGDTECVDSPG
CQPSCGCPGQQVLQDGQCVDPGQCRCKYLNSTTGVLESGNGSRVWPGNPMWQYTEPGETI
ISTCHNCTCEDGVLQCQSVPGCQVDGGWSQWGAWSECSAPCGGGAQFRLRQCDNPSPQGG
GRGCSGGAEQQRECNSQPCGDLGPWGEWSPWSQCSVTCGGGEQIRTRNCRLPPCSGPRQE
SKTCNTQVCLEVGCPPGRLYRECERGEGCPFSCDHVTGRVGCVSEGCEEGCHCPPGTFYH
QGTCVIECPCVVEEETLLALQNVSKSPAEAAVPLGSGGLRLHQGDELQPGDTLTYDCSSC
VCQHGQWNCSLSPCPQDGGLSPWGPWGSCSLSCGGLGQKTRTRSCTNPVPANGGQDCEGP
RHEITFCQTPDCPVFPVVTVPTEEPSGPEPSDGFGPWSIWSPCSRSCSDAAAPAVKSRWR
QCERESCAGETHQERACNLPQCPDGVPCRGEECAERNCSWTAWAAWSMCSRTCGVGQQHR
IRTYLAPGVNGTWCDDILGGNIETQFCNIRACRVDGGWSRWSPWSRCDRMCGGGRSIRTR
SCTSPPPKNGGNKCEGEKNQVKNCNTRPCDDSGCPPGQQYMECANRCPRLCSDLQQGIIC
QDNAECQPGCRCPPGLLEQEGVCVQSWQCECTDALGQRWAPGSRHQEGCNNCSCAEGRLS
CTNHSCAAAASCVWSVWSPWAPCSTSCGPGLRTRFRSQTSELADSDCQSEESQNKPCDLG
PCPPLCVRDNEELSIGDTWLQGECEQCTCTPEGDYCQDIDCQDELCPWSQWSECSRSCGA
GVSSRQRTCLCEAGKEGDVNCPPETEGERRKEETQLCYVQPCPDCPLSQWSEWTPCSCVS
QRQQRHRVSLPPTYKGQHCSELQTQSRACQPGDCQKCEEPFQFSACGSPCEKLCALQGQS
RDCAGKGQCVPGCYCPQGLLEQNGTCVPPEQCGCVHLLFPETGRTPIAIRVQEGTLVKSG
CRNCMCQDGAMQCDSQHCEEGKKLVSLSEWSEWTPCSPCRPVASLHLVTAPLLEDRQLVS
IQRRYRACMDLDTGLPVPEEPEQCGADLEEEQVCADPDACRDVCQWTDWSPWSTCREPCS
GGFRQRQRHPQTSAPMPHCQHPQFQTQSCNTALCPGERCEDRGKEFRASCANQCPRSCAD
LWEHVQCLQGPCHSVCLSGCRCAEGWLLQDGSCVPVSQCRCGVLRENGTLEILPGENVTM
DCNNCSCVNGTLLCTNLKCPEYSTWSPWSSCSASCEEGQRTRTRTCQEVPDSLPCAETFQ
TEPCLLQACPAGCVLSEWSSWSECSATCGGGVSLRNKTVLKEPDPGGQECPAPLEQHTAC
NTDSCEAECPDGQVFSSCATSCPHTCTDLWPETQCLLGVCQPGCSCSSGKVLHEGSCVPP
EMCPCSLLSLLPSWTLNLTLEQRQEEHPAGTVLQHHCNSCVCQRGIFNCSQNSCDVDCEW
DSWSAWSPCSVSCGSGEQWSSRVPTRSRQHGGAECEGPAERRRLCQERDCDCPVGERWKR
ASEQVAVCERSCQDMYLPGPVNCSAPGEWEGCVCDPGRYRSAKGDCVLAAHCECEDGETP
RQAGSQWSEGCATCRCVNGLKVCETGCPLVECVEGEVKVEDPGSCCPVCRKEFPEEPIAV
CRRYTEVRNITKGDCRLDNVKVSYCRGRCLSMTNVIAEEPYLQAVCECCSYRLDPQSPVR
ILSLQCESGETEPVVLPVIHSCECTSCQGGDLSKR
Download sequence
Identical sequences W5MQD1
ENSLOCP00000010590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]