SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000010958 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000010958
Domain Number 1 Region: 597-769
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-60
Family SPRY domain 0.0000249
Further Details:      
 
Domain Number 2 Region: 1-69
Classification Level Classification E-value
Superfamily RING/U-box 9.72e-17
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 313-385
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000181
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 4 Region: 77-136
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000198
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Domain Number 5 Region: 392-452
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000382
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000010958   Gene: ENSLOCG00000008984   Transcript: ENSLOCT00000010974
Sequence length 780
Comment pep:known_by_projection chromosome:LepOcu1:LG6:19729351:19751947:-1 gene:ENSLOCG00000008984 transcript:ENSLOCT00000010974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DELSCPVCYEIFRDPVVLSCSHSFCKVCLEQQWEQNSSWECPYCRTISKDKPPVSLSLKK
LCEAFLQERSQKSPGESEMLCSLHNEKLKLFCLDDKDPVCFICHTSRKHRNHEFCPLEEA
VVDCRENLSVELKTLQKKLKTFNKVKQTFDQTTEHIKSQTQLTKTLITEEFDKLHQFLRD
EEAARIAALKEEEEQKSQMMKKKTDSLTREISSLSDTIRAIEKEMGAEDISFLQNYKHTR
HSLNATPMINDPEGVSGALININIQLKKCQTTSVSVLKEYCDIMFKKILLKKKGLKLQSR
TYIITEEMAEKYSLLEENITCSVCKDIYKDPIVLTCSHSFCKNCMEKYWELKGSQECPLC
REFIKTQPHASLCLRNLCEAFTKERSQKPPTGSEVLCSLHSEKLKLVCMDDEEPICVVCQ
TSINHKNHELRPLEEALKDFKEDLNTALEPLQKKLETFCKVKQACNQTAEHIKMQTQQTE
RQIKEEFEKLQQFLLNEEAARIDALREEEEQKSQIMKENLESLTREISSLSDTIRTIKQE
MGTEDIQFLQNLKMKSLDLTQCTLLDPEEVSGALIDVAKHLGSLKYRVWEKMLGIVQYTP
VTLDPITANPHLSLSEDLTSVRYSAEKQQLPMNLERFDEHYCVLGFEGFTSGRHCWDVEV
GDTTYWLLGVSKESINRKGLMTLSPERGFWAIWHWEGSYSTLTSPGMRLTLKRKPQKIRV
QLDYERGEVSFSDPSDGTPIHTFKDTFTERVFPVFSPGVGFIPLRICPVKVSLMVVSNIG
Download sequence
Identical sequences W5MRE9
ENSLOCP00000010958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]