SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000011243 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000011243
Domain Number 1 Region: 168-428
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.27e-82
Family Eukaryotic proteases 0.0000168
Further Details:      
 
Domain Number 2 Region: 38-100
Classification Level Classification E-value
Superfamily GLA-domain 2.19e-24
Family GLA-domain 0.00029
Further Details:      
 
Domain Number 3 Region: 126-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family EGF-type module 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000011243
Domain Number - Region: 92-121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000312
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000011243   Gene: ENSLOCG00000009211   Transcript: ENSLOCT00000011259
Sequence length 436
Comment pep:known_by_projection chromosome:LepOcu1:LG14:18685790:18695457:-1 gene:ENSLOCG00000009211 transcript:ENSLOCT00000011259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPSFFGLFFLVTCFARSVSSSVFYSSQQAHMILRQKRANSFLEEIKPGNLERECMEETC
DYEEAKEIFKTKEATLKFWMQYTDGDQCVPNNCVNGTCIDQVGSYTCLCHPGFEGRHCDF
PVFATNCSEDNGGCDHSCQESGNGTSRRCGCLPGYTLADDGRSCQPSVPFACGKIVVDRT
PEKKITNPLTGLKPYVVGGEKGKKGHSPWQVLLINAQGKFHCGGVLIDNSWVLTAAHCLE
KGSRYHVRLGEYERYKLEDTEVTVPVSEVISHPHYDSNIADNDIALMRLSRPVPYSRYIL
PACLPPKGLAERVLLRNGTRMEVSGWGREKEGSSKSSSALRFIDIPLAPLSQCAEVMSQS
PTENMLCAGELGVKKDACEGDSGGPMVTKYKGTWFLVGLVSWGEGCGRTDKLGIYTKVSN
YLDWVQQVQSAKGSTA
Download sequence
Identical sequences W5MS84
ENSLOCP00000011243 XP_006638026.1.81211 XP_015217042.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]