SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000011268 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000011268
Domain Number 1 Region: 98-261
Classification Level Classification E-value
Superfamily RUN domain-like 5.75e-49
Family RUN domain 0.00000014
Further Details:      
 
Domain Number 2 Region: 627-693
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.01e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000011268
Domain Number - Region: 445-555
Classification Level Classification E-value
Superfamily Tropomyosin 0.00288
Family Tropomyosin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000011268   Gene: ENSLOCG00000009235   Transcript: ENSLOCT00000011284
Sequence length 697
Comment pep:known_by_projection chromosome:LepOcu1:LG5:18088250:18111435:1 gene:ENSLOCG00000009235 transcript:ENSLOCT00000011284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPAEHDLTLAEAESNKEKDQVFGILRLQEEKSTEKACSNLKAADGRWQAPIFALARKA
SETLSGSIHVLPKVVEQRTSPHFSDDWGAKALRDPMAMERANLLNMAKLSIKGLIESALS
FGRTLDSDYPPLQQFFVVMEHCLKHGLKVKKSFLGYNKSLWGPLELVEKLCPEAGEIAAS
VRDLPGLKTPQGRARAWLRLALMQKKLADYLRCLITRKDLLSDFYECSAVMLEEEGAVIV
GLLVGLNVIDANLCVKGEDLDAQVGVIDFSMYLKNDIDDYRSEERNGQIAAILDQKNYVE
ELNRQLNSTVQSLQGRVDSLEKSNTKLIEELAIAKNNIIKLQEENHQLRNENTLILMKAQ
QQLQATQGDVDVELDTYKQSRQGLDEMYNEARRQLREECQLRQDVENELVVQVSMKHEME
LAMKLLEKDIHEKQDTLIGLRHQLDEVKAINVEMYQKMQRSDDSLKQKNDIITRLEEKTN
QITATMKQLEQRLQQAERERWAAEEGARKFKQDFANKADSLQRQIAQREKQLHQLETDLK
IEKEWRQTLQNDLERERETISQLNTEAQQINGLKKEFHRLQDENRQLKRICEEQEQALQE
LGCKLSESKLKIEDIKEANKALQGGQVWLKDKDATHCKLCEKEFSISRRKHHCRNCGEIF
CNACSDNELPLPASPKPVRVCDTCHALLLQRCSSNST
Download sequence
Identical sequences W5MSA9
XP_006630501.1.81211 ENSLOCP00000011268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]