SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000012056 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000012056
Domain Number 1 Region: 235-470
Classification Level Classification E-value
Superfamily Caspase-like 6.88e-47
Family Caspase catalytic domain 0.00018
Further Details:      
 
Domain Number 2 Region: 94-189
Classification Level Classification E-value
Superfamily DEATH domain 2.12e-21
Family DEATH effector domain, DED 0.012
Further Details:      
 
Domain Number 3 Region: 9-76
Classification Level Classification E-value
Superfamily DEATH domain 0.0000953
Family DEATH effector domain, DED 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000012056   Gene: ENSLOCG00000009863   Transcript: ENSLOCT00000012077
Sequence length 471
Comment pep:known_by_projection chromosome:LepOcu1:LG12:24208895:24233078:1 gene:ENSLOCG00000009863 transcript:ENSLOCT00000012077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGHLSLTINQIADELNSEECKTLFYLCGNLDKCSSNEDVKDMLKALLKSGQVDHQFLL
LELTYRIKRFDILKRVLMTNRKEVESILGRKCFISDYRVLMADVSEELGKEDVRSFIFLL
SDTLPRMRLEKAKSFLDVIVELEKVDMVSHENLDLIEQCLRGIHRIDLAKKINVFQRKGA
KSTADLQIEREKRQCFRPSPEASSSQAVPQTVFQKSSTAHAPEKIKTGVPETGMQYSQLE
DVYRMQTDPRGICLIIDCVGNDGDMLHETFTKLRFKVILYKWLSLNDTLAFLKETARMTD
HQRLDCFVCCIISRGTATGMLGTETQGPGLLFDNIRQLFTPEHCPGLLGKPKLFFIQNYV
LSEPVPYYDDSDDIEADMPVVVHRVESIPTEADLFWSYCETEAGHLEKVHHSSVYFQALS
AGLIKGQKRKMDLIDVHTEVNGMIYDHNQRNPTNKYCISLRFTLRKNFILS
Download sequence
Identical sequences W5MUJ7
XP_015214614.1.81211 ENSLOCP00000012056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]