SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000012065 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000012065
Domain Number 1 Region: 230-468
Classification Level Classification E-value
Superfamily Caspase-like 2.69e-47
Family Caspase catalytic domain 0.00018
Further Details:      
 
Domain Number 2 Region: 94-190
Classification Level Classification E-value
Superfamily DEATH domain 4.47e-21
Family DEATH effector domain, DED 0.012
Further Details:      
 
Domain Number 3 Region: 9-76
Classification Level Classification E-value
Superfamily DEATH domain 0.0000953
Family DEATH effector domain, DED 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000012065   Gene: ENSLOCG00000009863   Transcript: ENSLOCT00000012086
Sequence length 469
Comment pep:known_by_projection chromosome:LepOcu1:LG12:24208895:24233078:1 gene:ENSLOCG00000009863 transcript:ENSLOCT00000012086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGHLSLTINQIADELNSEECKTLFYLCGNLDKCSSNEDVKDMLKALLKSGQVDHQFLL
LELTYRIKRFDILKRVLMTNRKEVESILGRKCFISDYRVLMADVSEELGKEDVRSFIFLL
SDTLPRMRLEKAKSFLDVIVELEKVDMVSHENLDLIEQCLRGIHRIDLAKKINVFQRKDR
NDALRIQNSTTLKFTAKCCKTLEKLHNKPSCSHHEFLSPEKIKTGVPETGMQYSQQLEDV
YRMQTDPRGICLIIDCVGNDGDMLHETFTKLRFKVILYKWLSLNDTLAFLKETARMTDHQ
RLDCFVCCIISRGTATGMLGTETQGPGLLFDNIRQLFTPEHCPGLLGKPKLFFIQNYVLS
EPVPYYDDSDDIEADMPVVVHRVESIPTEADLFWSYCETEAGHLEKVHHSSVYFQALSAG
LIKGQKRKMDLIDVHTEVNGMIYDHNQRNPTNKYCISLRFTLRKNFILS
Download sequence
Identical sequences W5MUK6
ENSLOCP00000012065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]