SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000012197 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000012197
Domain Number 1 Region: 503-801
Classification Level Classification E-value
Superfamily L domain-like 3.85e-43
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 22-434
Classification Level Classification E-value
Superfamily L domain-like 2e-41
Family Ngr ectodomain-like 0.007
Further Details:      
 
Domain Number 3 Region: 888-1044
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.45e-35
Family Toll/Interleukin receptor TIR domain 0.000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000012197   Gene: ENSLOCG00000009977   Transcript: ENSLOCT00000012218
Sequence length 1056
Comment pep:known_by_projection chromosome:LepOcu1:LG14:21059390:21065834:1 gene:ENSLOCG00000009977 transcript:ENSLOCT00000012218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVCSGPSSRVTTTILWVLISTTQAARWYPKSLPCDVTTPENGTTVLVNCNERRLTEVPK
EVPSNVTNLTLTINHIPFIDKTSFKGLENLTEIDFRCNCVPIKIGPKDHVCTKSLSVEDG
SFSALTNLRVLYLDGNQLSSIPRGLPPNLIVLSLEVNRFSSILKTNLSELTNVKYLYFGQ
NCYYRNPCNTSFQVEDGAFYHLKMLTLLSLKSNNMSYVPHNLPTSLKELYLYNNNIQRIS
KEDFQNMTNLEILDLSGNCPRCYNAPFPCVPCPNDSPIQIDLHAFQALKKLKILRLHSNS
LRKVPPEWFKHTDSLKVLDLSANFLATEITVAAFPKYLPRLEELDLSFNYEQQRYPASLC
LNESFSLLTSLKVLRIRGYVFKELRRTDITPLTKLSKLVIVDLGTNFIKMTNLNFLQDLK
SFQIINLSDNKLSSSSEEEQMNGFLSRDSSHSPVGSNAQYYNEEEKDIHYFRYDEYARSC
KDKDKEVGALSTSLNKKCSQFGKTLDISRNNIFYIDAKEFLGFGDLRCLNLSGNAMSQSL
NGSEFIHLTSLQYLDFSFNRLDLLYSTAFQELQNLTVLDLSYNNHYFLSEGLTHMLNFTK
NLPKLQKLMMNFNGISTSTNTEMESLSLEILEFKGNRLDFLWRDGDTRYSNYFKKLFNLK
LLDISSNNLNFIPKQVFMGLPDKLSELYINNNNLKTFSWEKLDHLNQLQILDLSTNQLTT
VPYELSNCTKSLQKLLLSNNQISKLTTYFLRDAFSLKYLDLSFNQIQYIEQSSFPENIRN
HLEILLLNGNKFMCTCDAVWFVLWINQTTVKIPRLATDVTCATPRTQKDRSVIFLDLQTC
EHNSLSIILYILLTSAILSLLSLSISSHLFFWDVWYFYHFCAAKMKGYRSLSSQSSCYDA
FIVYDRKDQAVSEWVFHELRANLEDRGDMQFQLCLEERDWIPGYPLIDNLSQSIQQSKKT
VFVLTNRYILSGNFKTAFYIAHQRLMDEKADVIILIFLEKCLQYSKYLRLRKRLCRSSVL
EWPSNPQAQHYFWLCLRNTMATDGHTQYNNPFEETL
Download sequence
Identical sequences W5MUY8
XP_015216940.1.81211 ENSLOCP00000012197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]