SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000012206 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000012206
Domain Number 1 Region: 481-779
Classification Level Classification E-value
Superfamily L domain-like 1.09e-44
Family Ngr ectodomain-like 0.0038
Further Details:      
 
Domain Number 2 Region: 873-1022
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.1e-36
Family Toll/Interleukin receptor TIR domain 0.0000609
Further Details:      
 
Domain Number 3 Region: 40-424
Classification Level Classification E-value
Superfamily L domain-like 9.86e-34
Family Ngr ectodomain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000012206   Gene: ENSLOCG00000009982   Transcript: ENSLOCT00000012227
Sequence length 1039
Comment pep:known_by_projection chromosome:LepOcu1:LG14:21068100:21073657:1 gene:ENSLOCG00000009982 transcript:ENSLOCT00000012227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTTSPLQNRMLCLFVITTFVPSILTNCWVSKHLPCDVMIRNDTSILFDCSARRLTVVPT
DIKCNVTSLRLSQNQIQHISNESFWNLENLIILNLKWNRDTEGLKIAKGSFTALKKLKIL
LLDGNLLSTIPEDLPHELNILSLSSNNIASIGSENFKGIPNIKEIRLNKNCYHGNGCNNS
LIIHNDTFSNVLELEKLSLNLNRLTRVPQNLPKYLKSLSLTLNKIERVNHFDLENLTELR
TLDLSGNCPRCQNAPFPCETCKTPKGSIEVDPHAFQSLVNLEELHLSGNSLVKVHASWFQ
NCTKLKYLFLSFNFLISEIATGEFLNVLPHVEVIDLSFNYAPKSYPRKIKLSSNFSKLEA
LRALHIEGYVFRILDGNDLNPLFSLKNLSLLNVGTNFLQYIHLTLFQNFFNLSLIYLSEN
RLASLSQRNDSIYANGNEADCVLNKPLMKYHGNHEEKGTYIVHKDKDYRLSHPLVKQQCL
RYGPVLDLSKNNIFYISPELFKGLENTTCLNLSKNSIADSFNGTEFIHLPKLKYLDLSYN
KIDLAYDYAFSELTHLEVLDLSNNPHYFVVAGVTHNLNFVKHLQVLKVLNLSQNEIFTLT
EKEMSSSSLKELQFQGNRLDILWKNDERYIRLFTNLLNLTHLDMSHNKLQNIPSAAYENF
PKTLTHLFLNNNKLNLFKWEKLIYFECLEVLDLSNNKIESIAEHIANYTKMLRKLYLGNN
KISRLSDGFLRGARSLSRLYLDNNNLSLINTSTFLSGPENYLKTLSLKGNPFQCTCEIFD
FLLWVEGTDIVIPRLATDVTCATPERLKRNAVIGFDRQQCIIDGTSAILFLASSSIIVIT
VAVAITQHLFYWDVWYIFHYLKAKMKGYHYLKSTESIYDAFITYDTKDPVVSDWVLNHLR
VQLEENGEKLFPICLEERDWHPGAPVIDNLSQSIKQSRKTVFVLTEGYVKSGTFKIAFYL
AHQRLLDDNTDVIVLVLLEPVLLHSQFFRLRKRLCRKTILEWPKNPRAEKWFWHCLRNII
RVEHQAVYNKLYSCYFINK
Download sequence
Identical sequences W5MUZ7
XP_015216941.1.81211 XP_015216942.1.81211 ENSLOCP00000012206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]