SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000013064 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000013064
Domain Number 1 Region: 576-619
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000776
Family Ovomucoid domain III-like 0.007
Further Details:      
 
Domain Number 2 Region: 669-706
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000061
Family Ovomucoid domain III-like 0.045
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000013064
Domain Number - Region: 711-742
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000236
Family Ovomucoid domain III-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000013064   Gene: ENSLOCG00000010656   Transcript: ENSLOCT00000013092
Sequence length 920
Comment pep:known_by_projection chromosome:LepOcu1:LG9:30058187:30105214:1 gene:ENSLOCG00000010656 transcript:ENSLOCT00000013092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRQECLQLSTIKSESRLKHLLQRLPSYCPESMNELWVCINSTLPGASKKSEGWVGLGCCE
LAIDPDCRQECKLASSKNDIRKKCEKGFENALYSCISRNEMGSVCCSYAGRHTNCREYCQ
AIFRTDSPPTLSQIKAVEDYCQSISPELISCVENYTESYPIKNPIDSLYCCERADDAHCQ
TACKRILRTMKTENEIIDGLIKECDKQPLPQDPLWQCFLGNAGSGNNGVSVDTSPSTGLD
SAKLHCCYKANTTICRELCFTVSTNWGSTQSWQEFDQFCEYNPMEAAMVNCLADVREPCQ
LGCKDLTYCTNFNNRPTELFRSCNAQSDQGAMSDIKLWEEGSIKMPFMNIPVLDIRKCRP
EMWKAVACALQIKPCYSKSRGSVICKSDCVDILTHCGDHSKFNEGQSPETICDLLSPTDD
PERCIPLQRYLSPSSLGDIIEEVIHPCNPNPCPSNQLCEVNRKGCQPGQECLPYFCVQGC
KLGEASEFLVHRRALIQVPSPKGEVGCYEICTCGQSGHLENCVDMPCVDTEKTCIVGGQR
QSHGTSFKVDCHTCSCFAGEIVCSTRQCLSKQSSEEDRRRFTGLPCGCADQFVPVCAKNG
RTYPSACVARCMGLKDNQFEFGTCRDSDPCFPNPCRKGQRCIPKRKVCLTSIDDYPCTQY
ECLTFSGPCDHSLVDPVCDIDNMEHPNLCELYKSGKTLAYIGHCQDACKKPNPVCGHNGE
TYCTVCAAYSDRVAVDYPGRCHAVGVVSEVSTDSGCATINCPALPTKGCNPVIPPGACCP
LCAGMLQILWTKEQMNVFAKLNNNKPVTIHDILQILRLHISVPQCDIFGYLSIDSEIVIL
IVPVDERPTPLQIEACNKEAEKIDSLINYGSPTLVSHVPLSAFTVSEVKVSTLTSAAPAL
AMPVYFSLLLSFSFTLFVSL
Download sequence
Identical sequences W5MXF5
ENSLOCP00000013064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]