SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000013186 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000013186
Domain Number 1 Region: 235-492
Classification Level Classification E-value
Superfamily Caspase-like 1.26e-78
Family Caspase catalytic domain 0.000000465
Further Details:      
 
Domain Number 2 Region: 7-90
Classification Level Classification E-value
Superfamily DEATH domain 5.77e-22
Family DEATH effector domain, DED 0.0048
Further Details:      
 
Domain Number 3 Region: 101-193,238-264
Classification Level Classification E-value
Superfamily DEATH domain 6.94e-18
Family DEATH effector domain, DED 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000013186   Gene: ENSLOCG00000010756   Transcript: ENSLOCT00000013214
Sequence length 494
Comment pep:known_by_projection chromosome:LepOcu1:LG12:31224287:31243869:1 gene:ENSLOCG00000010756 transcript:ENSLOCT00000013214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDSMFSILFEIDEDLDSSEIEALKFLCLDHIPKRKQENIKDAKGLFLSLRDKGLLDMED
YFIVAELLYIIKRVKLLGLLGTSKQHVQERLKNRVDSRTGISSYRRMLYELSEDVTDEEL
KSVKFFLSEKIQRCKLDVSASFLDVLIEMEKQEILGEDMLSELEGICKKINMNLVQRIME
YKQSREEEPCAMEASTDLTRQQPQLNLQEAQSVRPPVNNSVRERTLSLDGLPVAIHSESE
VYDMRNKPHGYCLIINNKNFDKGRRRYPEKYLKDRIGTDIDAASLTSTFETLDFEVIRRD
DLAASEILAFMEEYGRKDHRQRDAFVCCILSHGVKGAIEASDGEPVLIRQITSYFTSSNC
VSLIRKPKLFFIQACQGQNKQPGVSIVSDGHSEAQREIEADAGVIQQDTIPDDSDFLLGM
ATVEDYLSYRSTSRGSFFIQALCKHLQEGCRKNEDILSILTKVNREVSQGTYVNAKQMPE
PRYTLTKKLIFPVS
Download sequence
Identical sequences W5MXS7
XP_015214951.1.81211 XP_015214952.1.81211 ENSLOCP00000013186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]