SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000013212 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000013212
Domain Number 1 Region: 222-468
Classification Level Classification E-value
Superfamily Caspase-like 6.28e-78
Family Caspase catalytic domain 0.000000471
Further Details:      
 
Domain Number 2 Region: 8-88
Classification Level Classification E-value
Superfamily DEATH domain 2.59e-16
Family DEATH effector domain, DED 0.0089
Further Details:      
 
Domain Number 3 Region: 99-188,219-245
Classification Level Classification E-value
Superfamily DEATH domain 6.94e-16
Family DEATH effector domain, DED 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000013212   Gene: ENSLOCG00000010778   Transcript: ENSLOCT00000013240
Sequence length 470
Comment pep:known_by_projection chromosome:LepOcu1:LG12:31263470:31282915:-1 gene:ENSLOCG00000010778 transcript:ENSLOCT00000013240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAINDLFQITEQLSTDDVPALRFLCSDLITAKSQEKIVDGKGLILELRKASLVEEGDC
FILAELLYWIGQNKLLKYMNVTKEMVQEQLQNNNVSRVSPFRKILYEVSQDISSDDLNNM
KFLLSDKFGASLENMDIYDIFTAMEKREMLADNNFEELKKIFGQMSPRLLKKIEDYETHN
KDKPLQEESEVVSNLSQMSLCNTTEQGKPVSQEESCVIQNKEYKMSSLPRGYCLILNNFD
FVEKRIQNRWGTEHDAKALEEVFCWLGFEVKRHDDLKAAEMRAKLEEYGKASHQGKDCFV
CCVLSHGEQQCVVGTDGEKVEIKDIVSCFDGKKCPSLVQKPKVFFIQACQGKEFQESVEA
QGDGCFPVVRLESDDSGIYRVPVDADVLIGMATVQECLSMRDVRSGTWYIQSLCRQLREG
CPRGDDIHSILTKVNEEVSKEEGTIKRIKLAKQIPEPRYTLTKKLVFRVP
Download sequence
Identical sequences W5MXV3
XP_015214953.1.81211 XP_015214954.1.81211 XP_015214955.1.81211 XP_015214956.1.81211 XP_015214957.1.81211 ENSLOCP00000013212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]